KEGG   Hydra vulgaris: 100205517Help
Entry
100205517         CDS       T01080                                 

Definition
ubiquitin carboxyl-terminal hydrolase 14-like
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
hmg  Hydra vulgaris
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 453 aa AA seqDB search
MATYSVHVKWGKEKFDNVEVNTAEPPELFQAQLFALSGVPIQRQKIMGKGKTLKNDSWDG
FTLKDGMTLLMMGSNELVPTPQLGTKFIEDMSSTELNKASSFPAGLTNLGNTCYMNATIQ
CLKNVPELKQALERYDGKLNIGSIMSMPSDAITISLRDLYNVMNKTSAAVPPIMFLQVLH
AVFPHFAEKSEQGGFMQQLDSSLKCDETDLEAETTLTEHFYQLSCFISQDIKYLNSGLKS
RLKETITKASPVLGKDALYTKSSLISRLPAYLTIQFVRFFYKEKEKVNAKILKDIKFPMT
LDVFELCSSELQEKLKPMRDKFKEEEDKRANEKLLQISIAANNKKLPFEFSDGRIFKMLS
RLVFLQDIGSNNSGYYELSAVLTHRGRSSSSGHYVAWIRKQEDEWLMCDDDNVYAVTSED
ILKLSGGGDWHCAYVLLYSPKSLIVADEKNDHH
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctatagcgttcatgtaaaatggggcaaagaaaagttcgacaatgttgaagtt
aatactgctgaaccacctgaactgtttcaagctcagttatttgctctatctggtgtacct
attcagaggcaaaagatcatgggcaaaggaaaaactctcaaaaatgattcatgggatgga
tttactttaaaagatggtatgacactacttatgatgggtagtaacgagttggttccaacc
cctcaacttggcaccaaatttattgaagatatgtcaagtacagaattaaataaagcatct
tcttttcctgctggtttaacaaatcttggaaacacctgttatatgaatgcaaccattcaa
tgtttaaaaaatgtaccagagttaaaacaagcactggaaagatatgatggcaaattaaat
ataggaagtataatgtctatgccatctgatgctatcactatatcgctacgtgacttatat
aatgttatgaataaaacatcagcagctgttccacctattatgtttcttcaggtattgcat
gcagtgtttcctcattttgctgaaaaatcagaacaaggaggttttatgcagcagcttgat
tcaagtctaaaatgtgatgaaacagacctggaagctgagacaacattaacagaacatttt
tatcagcttagttgctttatttctcaagatataaaatatttaaacagtgggttaaaatca
aggttaaaagaaactatcacgaaagcttctccagttttaggaaaagatgcattatataca
aaaagttccttaataagtcggcttccagcataccttactatccagtttgttcgatttttt
tataaagaaaaagaaaaagtcaatgcaaaaatattaaaggatataaaatttccaatgaca
ttagatgtgtttgaactttgcagttcagaattacaagaaaaattaaaaccaatgcgtgat
aaatttaaagaagaagaagataaaagagctaatgaaaaactgttacaaatttcaattgct
gctaataataaaaaacttccgtttgaatttagtgatggtaggatatttaaaatgttaagc
agacttgtttttcttcaagatattggatcaaacaacagtggttactatgaattatctgct
gttctcacacatcgtgggcgttcttcgtcatctggacattatgttgcatggatacgcaaa
caagaagatgaatggctaatgtgcgatgatgacaatgtatatgcagttacatctgaagat
attttaaagctttctgggggaggagattggcactgcgcctacgttctactttactcgccg
aaatctctcatagtggccgatgaaaagaacgatcatcattga

DBGET integrated database retrieval system