KEGG   Hydra vulgaris: 100206478Help
Entry
100206478         CDS       T01080                                 

Definition
(RefSeq) probable elongator complex protein 3
  KO
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100206478
Transfer RNA biogenesis [BR:hmg03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    100206478
Chromosome [BR:hmg03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100206478
   HAT complexes
    Elongator complex
     100206478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 549 aa AA seqDB search
MKQKNKEYSSFSNSELMAFTVTDIISELLAAQESKKVVDLNKLKSSISSKYGLSTQPRLV
DIIAAVPAQHKKLLLPKLKAKPVRTASGIAVVAVMCKPHRCPHISMTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRARYNPYLQTRHRIEQLKSLGHSVDKVEFIVMGGTFMALD
EEYRDYFIRNLHDALSGHTSNSVEEAVRYSEKSKTKCIGITIETRPDYCLKRHISSMLLY
GCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFQLGKDSGYKVIAHMMPDLPNVDMERDI
EQFVEFFENPAFRADGLKIYPTLVIRGTGLYELWKTGRYKSYPPGALVDLIARILALVPP
WTRVYRVQRDIPMPLVTSGVEHGNLRELALARMKDFGTECRDVRTREVGIQAIHKNIRPY
EIELIRRDYVANQGWETFLSYEDPDQDILVGLLRLRKCSEDVFRPELKGGCSIVRELHVY
GSVVPINARDPTKFQHQGFGTLLMEEAARIAKEEHFSKKIVVISGVGTRDYYRKLGYSLD
GPYMSKLLT
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaaaaacaaggagtattccagtttttctaattccgagctgatggcatttact
gttactgatataatcagtgaactgctagctgcacaagaaagtaaaaaagttgttgattta
aataagttaaagagtagtatatcttctaaatatggtttatctactcagcctcgcctagtt
gatataattgcagctgttccagcacagcataaaaagttacttttaccaaaactcaaagca
aaacctgttcgcacagcttctgggattgctgtagttgcagttatgtgtaaaccgcatcgt
tgtcctcatatcagtatgacaggaaacatttgtgtttactgtcctggaggaccagattct
gattttgaatactcaacacaatcctacactgggtatgaaccaacttcaatgcgtgcaata
cgtgctcgttataatccttacttgcaaacacgacatcgaattgaacaattaaaatcactt
ggtcacagtgtggataaagtagagtttattgttatggggggtacatttatggcattggat
gaagagtacagagattattttattcgcaatttgcatgatgccctgtcaggtcacacaagt
aacagtgtcgaagaagcagtgcgatattctgaaaaaagcaaaaccaagtgtattggtata
acaattgagacacgccctgactactgtctgaaacgacacatcagttccatgctgttatac
ggctgcactaggttggaaataggagttcaaagtgtatatgaagatgttgcacgagatact
aatagaggtcacacagtcaaagctgtatgtgagtcgtttcaattgggtaaagattcgggt
tacaaagtaattgctcacatgatgccagatttacctaatgttgatatggaacgagatatt
gagcagtttgttgaattttttgaaaaccctgcgtttagagcagatgggttaaaaatatat
ccaactttagtaattcgtggaacaggtttgtatgagctttggaagactggccgatataaa
agctatcctcctggtgctcttgttgacttaattgctcgtatacttgctcttgtaccccct
tggacacgtgtttaccgagtccagcgtgatatacctatgccacttgtaacatctggtgta
gagcatggaaatttaagagaattagcacttgcaagaatgaaagattttgggactgagtgt
cgagatgttcgtaccagagaagttggtatacaagcaattcataaaaatattcgaccttac
gaaattgaacttattcgtagagattatgttgcaaatcaaggttgggaaacatttttatct
tatgaagatccggatcaagatattttagtcggactactacgcttgcgaaaatgttctgag
gatgtgtttcgacctgagcttaaaggtgggtgctcaatagtacgcgaacttcatgtctat
ggaagtgttgtaccaatcaacgctcgggatccaacaaagtttcagcaccagggttttgga
acattactaatggaagaagctgctcgtattgccaaagaagaacatttttctaaaaaaata
gttgtgatatcaggtgttggtactcgcgattactaccgaaagctcggctattctcttgat
ggtccctatatgtctaaattattaacataa

DBGET integrated database retrieval system