KEGG   Hydra vulgaris: 100206478Help
Entry
100206478         CDS       T01080                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hmg  Hydra vulgaris
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 514 aa AA seqDB search
KVVDLNKLKSSISSKYGLSTQPRLVDIIAAVPAQHKKLLLPKLKAKPVRTASGIAVVAVM
CKPHRCPHISMTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYLQTRHRIE
QLKSLGHSVDKVEFIVMGGTFMALDEEYRDYFIRNLHDALSGHTSNSVEEAVRYSEKSKT
KCIGITIETRPDYCLKRHISSMLLYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFQL
GKDSGYKVIAHMMPDLPNVDMERDIEQFVEFFENPAFRADGLKIYPTLVIRGTGLYELWK
TGRYKSYPPGALVDLIARILALVPPWTRVYRVQRDIPMPLVTSGVEHGNLRELALARMKD
FGTECRDVRTREVGIQAIHKNIRPYEIELIRRDYVANQGWETFLSYEDPDQDILVGLLRL
RKCSEDVFRPELKGGCSIVRELHVYGSVVPINARDPTKFQHQGFGTLLMEEAARIAKEEH
FSKKIVVISGVGTRDYYRKLGYSLDGPYMSKLLT
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
aaagttgttgatttaaataagttaaagagtagtatatcttctaaatatggtttatctact
cagcctcgcctagttgatataattgcagctgttccagcacagcataaaaagttactttta
ccaaaactcaaagcaaaacctgttcgcacagcttctgggattgctgtagttgcagttatg
tgtaaaccgcatcgttgtcctcatatcagtatgacaggaaacatttgtgtttactgtcct
ggaggaccagattctgattttgaatactcaacacaatcctacactgggtatgaaccaact
tcaatgcgtgcaatacgtgctcgttataatccttacttgcaaacacgacatcgaattgaa
caattaaaatcacttggtcacagtgtggataaagtagagtttattgttatggggggtaca
tttatggcattggatgaagagtacagagattattttattcgcaatttgcatgatgccctg
tcaggtcacacaagtaacagtgtcgaagaagcagtgcgatattctgaaaaaagcaaaacc
aagtgtattggtataacaattgagacacgccctgactactgtctgaaacgacacatcagt
tccatgctgttatacggctgcactaggttggaaataggagttcaaagtgtatatgaagat
gttgcacgagatactaatagaggtcacacagtcaaagctgtatgtgagtcgtttcaattg
ggtaaagattcgggttacaaagtaattgctcacatgatgccagatttacctaatgttgat
atggaacgagatattgagcagtttgttgaattttttgaaaaccctgcgtttagagcagat
gggttaaaaatatatccaactttagtaattcgtggaacaggtttgtatgagctttggaag
actggccgatataaaagctatcctcctggtgctcttgttgacttaattgctcgtatactt
gctcttgtacccccttggacacgtgtttaccgagtccagcgtgatatacctatgccactt
gtaacatctggtgtagagcatggaaatttaagagaattagcacttgcaagaatgaaagat
tttgggactgagtgtcgagatgttcgtaccagagaagttggtatacaagcaattcataaa
aatattcgaccttacgaaattgaacttattcgtagagattatgttgcaaatcaaggttgg
gaaacatttttatcttatgaagatccggatcaagatattttagtcggactactacgcttg
cgaaaatgttctgaggatgtgtttcgacctgagcttaaaggtgggtgctcaatagtacgc
gaacttcatgtctatggaagtgttgtaccaatcaacgctcgggatccaacaaagtttcag
caccagggttttggaacattactaatggaagaagctgctcgtattgccaaagaagaacat
ttttctaaaaaaatagttgtgatatcaggtgttggtactcgcgattactaccgaaagctc
ggctattctcttgatggtccctatatgtctaaattattaacataa

DBGET integrated database retrieval system