KEGG   Hydra vulgaris: 100206696Help
Entry
100206696         CDS       T01080                                 

Definition
beta-galactosidase-like
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
hmg  Hydra vulgaris
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100206696
  Lipid metabolism
   00600 Sphingolipid metabolism
    100206696
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100206696
   00604 Glycosphingolipid biosynthesis - ganglio series
    100206696
   00511 Other glycan degradation
    100206696
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100206696
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     100206696
Exosome [BR:hmg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100206696
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 620 aa AA seqDB search
MKVIFVLISIFVIYETSESRLKRSFSIDFENNCFLKDGSPFRYISGSMHYFRIPKLYWND
SMKKAKSMGLNTIQSYVAWNIHEINEGHYDFNDDKDIINFINLAQQNDLLVILRPGPYID
AEWEFGGFPWWMAKSNMTMRTSGDKSYMKYVSNWFSILLPMINQYLYKNGGPIIAVQVEN
EYGNYYACDHEYMKELKNLFQLHLGNDVVLFTTDGYTDDYLKCGTIPSLFTTIDFGTEIS
AVEAFKLLRNHQKKGPLVNSEFYTGWLDYWGKNHQKRNARNIALHLDEILKLNASVNLYM
FQGGTNFGYMNGADMSDGQFLISPTSYDYDAPISEAGDLQAKFFSIRNVIQKYTDFPLPP
VPIPSVKMAYGKVFMKSFTNLNQAINLFCSISRPEHSKKPLRFEEANLGYGFMLYQTELP
DVNVNNYLEIEEVNDRSTVYVDGVKQGCASRGQVALNITKGKTLEILVENQGRLAYATKG
VKYLPDVKGILSEVRINQKIINEWLMFRINDSVVNNLQKMNKSTTKQNSTGLFFFSSFFI
EKIHDTYIKMNGWKKGQIYINNYNIGRYWSIGPQQTLYIPKSFLKKKKNTVTIFELDEAP
CLLTKIRECFIEFVDKPILG
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttatatttgttttaatatctatttttgtaatctacgaaactagtgaatctcgt
ctaaaacggtccttttcaatagattttgaaaataattgttttttgaaagacggaagccca
ttccgatatatatctggaagtatgcattactttcgaataccgaagctatattggaacgat
agcatgaaaaaagccaaatcgatggggttaaatacaattcaatcttatgttgcatggaat
attcacgagataaatgaaggacattatgactttaatgacgataaagatatcatcaacttt
ataaatcttgcccagcaaaacgatcttttagtgatactgcgtccaggtccttatattgac
gctgaatgggagttcggaggttttccttggtggatggcgaaaagcaatatgacaatgaga
acatcaggagacaaaagttacatgaagtacgtttcaaactggtttagtattttactacct
atgataaatcaatatttatacaaaaatggcggaccgattattgctgtacaagttgaaaac
gagtacggtaactactacgcttgcgatcacgaatatatgaaagaattgaaaaacttattt
caactacatcttggaaacgacgttgtactttttactactgatgggtatactgacgattat
ttaaaatgtggtactattccttctctttttactacaattgactttggaacagagatctca
gcagtggaagcttttaagttattgagaaaccatcaaaaaaaaggacctttagtaaactct
gaattttatactggatggctagattactggggcaaaaaccatcaaaaaagaaatgcaaga
aatatagctttacatcttgatgaaatcttaaaattaaacgcttcggtaaatttatacatg
ttccaaggaggaacaaactttggctatatgaatggtgctgatatgagcgatggccagttt
ttaatttcaccaacaagttatgattacgacgcaccgatatctgaagctggagatttacaa
gcgaaatttttttccataagaaacgttattcaaaaatacaccgactttcctttgccacca
gtacccataccctctgtaaaaatggcgtatggcaaagtctttatgaaaagttttacaaat
ttgaatcaagctataaatcttttttgctcaatcagtcgtccagaacattctaaaaaacct
ttaaggtttgaagaagcaaacttaggctatgggtttatgttgtatcaaacggaattaccc
gatgtaaatgtaaataattatttagaaattgaagaagtcaacgaccgttcaactgtatat
gtagacggtgtaaagcaaggttgcgcaagtcgaggacaagtggctttaaatattaccaaa
ggaaaaacattggaaattctagttgaaaatcaaggaagactagcttacgcaactaaagga
gttaaatatcttcctgatgtgaagggaatcttaagtgaagtacgaattaatcaaaagatc
attaacgaatggcttatgttccgcattaacgattcagtggttaacaatcttcaaaaaatg
aataaatcaacaacaaaacaaaactcaacaggattgttttttttctcatcgttttttata
gaaaaaatacacgatacatacattaaaatgaatggatggaaaaaaggtcaaatttatata
aacaactataatattggtagatactggtcgataggtcctcaacagacactttacatacca
aaaagttttcttaaaaaaaaaaagaatactgttacaatttttgagcttgatgaggcgcct
tgtttacttactaaaatacgggagtgttttatagaatttgttgataaacctattttaggt
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system