KEGG   Hydra vulgaris: 100206699Help
Entry
100206699         CDS       T01080                                 

Gene name
usp9x
Definition
ubiquitin specific peptidase 9, X-linked
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
hmg  Hydra vulgaris
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2142 aa AA seqDB search
SMKLIVSCLPGQEELCKQFEELRLLMILRLLQVSPFNGKMNALNEINRVISSVSYYSNHR
HNNYEEDEYLTNDMVAKWLQENNVLVIVLKDNLHQPQYVEKLEKIIRFTIKSKTLTVKDL
DTIWMAQLGKHEAIVKNVHDLLAKLAWDFSAEQLDHLFSRFQAGWNSANKKQQEKLLELI
RRLAEDDKEGVIAHKVLNLLWQLAHSDDLPTDIMDQALNAHIKILDYSCSQTQDRDNLKI
HWIDLCVEEIKVGSWVIPALKQIRAICELFYENGNQVSNHHILYRNTVVESIQNKHAIVS
LVAENLTKYMSKIRNLYQNDTSIIPEELLPDRRYPHVRQIQERLDFLRFILNDGKMWLCQ
PQAEQIWVCLAINSVFPVDQDICFKWFSVVMGDDPDLDPDITRQFFENNVLKTDPTMLNE
HGLKCFERFFKFVNLKEGYLQKKRNGAFVLEHTQLIGYDYLWKVITQASVDIVTQAIEVL
REIYTNIGSQLKQSEIHSMFIKTCSDRIHPCEEIMCNTDYNTPTGKATMLEQARKVTACL
RALKVYIEESDKNYCIERAIPAHERSARGKQICLYVRFPQQNRQIEDFEVWSHSNESIAS
LRRRIYVRLKNIVQAIKLDICYNNDVLNPTDDRKLISDLPIKDRGVFTIKLGSSSNSIPS
SPDSSSDTSPPPTPLCGDGPNVETEHLLPSVILSRTKFVQTLFTLGDLAMKFHLEELQNI
VLNLLNICSSDVETINNIKTLCHNSMIKGMSSLDKLFSIVTPIQALYNLEIIYALLLPAM
EPLENYPISFQHSIILAGGIDSILNLFTNKTFLHGANTLIKRMAYTVLFKISKLFLTTIC
FAHITVVAEALHKDSGKDIAVSSAQHNYAIVLQQATQHIPNTYFEFVLRSISVKLGQALG
SRATKYMPDINFVKVVQKICWSAAAGDVSLHQTDVIHIHQFFEKHEELQKCASLDDSNLA
KEAFEVMTIALTLCPPILETLIRDNSWHLFIVDTLLLCTSRSINFQLQNATKIMEQELKW
LRNVQTAYFSVESSHESTDDVLLEGHLGIIKELLQYHSIQKRYHIGCEEGGEKLIERLLN
DFVFSSSRSLLAARRGVYLDQVHPMCKTQQTIVAALELLISLASNCVPNLRLIAEYLTQI
YYSGYDSPITEWEYQPPIGPRPENGFVGLKNAGATCYMNSVLQQLCMIPEIASGVLSVDV
GYNEDDDNQHEKTVLNIDNDVTSSSSENKELVEKNKQKERQQYNKKVLCQVQAIFGHLYG
SKLQYYIPHGFWQVFRLWGEPVNLREQHDAYEFFNTLVDNIDEALKALGHNTVCSNILGG
SFADQKICKQCPHRYSRETPFTAINVDVRNHHNLIDSLEQYVKGDLLEGANAYYCERCDK
KVDTVKRLCIRKLPKVLAIQLKRFDYDWERDCAVKFNDYFEFPREFDLEPFTVEGLAKLE
GEIIEEDIIDQANKTPFIVDDEKEKSTIYKLVGVTVHSGQASGGHYYSYITNRSKSSGKQ
SWYKFDDGDVSDCNMDDEEELKNQCFGGEYMGEVFDHMMKRFQFRRQKRWWNAYLLFYER
LDVASKTNRENSSSCGKLIMPSAIEKSVSQENIQFLHTKMQFSQEYFQFIRKLVLSSLSP
QAHSSPHKPNDPARDELHFICLQLLSKFLFTVCFHTKKNIRGPANEWYETVAVLVRQSPS
LRRWFVIEVLLSRPDRIIEYLLECPVAEIRSAFGRIIILLAHLTRNDGCFSIELLNSPLE
PWQVSDLDATKATISDYLMRTVIEVLHRESSENNPRHLLQYFQLFVMYAGIGPAERKQLL
DLGVLLTFIRLALEEEFNNSVKYQNVESAKLYSLVSVLIRSCDVTKYMNSAIKGEQCKPN
PYLDSMATTPIMEIPSDVEGMIYTSNCIKKFLEESNNSEDTIQLIKFLSWECLSFSLIAL
SEVLFSISYAYTYELRPFLDILLHLLLMNDSWQEQRLKSAFNGVSDDREGLFDTIQRSKS
HSHKRGYQCIKAIVQLIQNCELAHQILMKSEELKAKWKSAIIWLGEELDRRAPSAYNYNN
WSPPTASNENSNGYFLERSQSARFTYAKARELFDESEEEEPEDEVVEHLPKQYNDEFSDN
HRPLRYCGSESDAIQVPKLLSDSVVHLDISNDASLNDDESDS
NT seq 6429 nt NT seq  +upstreamnt  +downstreamnt
agtatgaaattgattgttagttgtttacctggtcaagaggagctatgtaagcaatttgag
gagctacgcctattaatgattcttagattactccaagtttcgccatttaatgggaaaatg
aatgcgttgaatgaaataaatcgtgttataagcagtgtctcctactacagtaatcataga
cacaacaattatgaagaagatgaatacctcacaaatgatatggtagcaaagtggttgcaa
gaaaataatgttttagttatagtcttaaaagataatcttcaccaacctcagtatgtggaa
aaattggaaaaaatcatacgtttcactataaaatcgaaaacgctgactgttaaagatcta
gatacaatatggatggcacaattaggtaaacatgaagctatcgttaaaaatgtccacgac
ttgttagcaaaacttgcttgggatttttctgcagaacaacttgatcatttattttcgagg
ttccaggctggttggaattcagctaataaaaaacaacaagaaaagttgcttgaactgatc
agaagacttgctgaagatgacaaagaaggagtgattgctcacaaagttcttaatttgtta
tggcaacttgcgcatagtgatgatttgcctactgatataatggaccaagctctgaatgct
cacataaaaattcttgattatagttgttctcaaactcaagatcgagataatttaaagata
cattggattgacttgtgtgtggaagaaataaaagtaggttcttgggtcattccagcctta
aagcagattcgggctatttgtgaattattttatgagaatggcaatcaggtatcaaatcac
cacatattatatcgcaatacagttgtggagagtattcaaaataaacatgctattgttagt
ctagttgctgaaaatcttacgaagtatatgtctaaaatacgtaatctttatcaaaatgat
acatctattattcctgaagagcttttacctgatagaagatatccacatgttcgccagatt
caagaacgtcttgactttcttagatttatattaaatgatggaaagatgtggttgtgccaa
cctcaagccgagcagatctgggtttgtctagcaattaattctgtttttcctgtggatcaa
gatatttgttttaaatggttttctgtggtaatgggagatgatccagatttagacccagat
ataactaggcaattctttgaaaataatgtcctgaaaactgatcctaccatgctgaatgaa
catgggttgaaatgttttgagcgttttttcaagtttgtaaatttgaaagaaggttacctt
caaaaaaaaagaaatggcgcatttgttcttgagcatacacagttgattggttatgactat
ctatggaaggttattactcaagcttccgtggatatagttactcaagcaatagaagtactt
cgagaaatttacacaaatataggctcgcagttaaagcagagtgaaatccattcaatgttt
attaaaacttgtagtgatcgcatacatccatgtgaagaaataatgtgcaacactgattat
aatactccaactggaaaagctactatgcttgagcaagctcgcaaagtaactgcatgcttg
cgagcccttaaagtttatattgaggagtctgacaaaaattattgtattgaacgagctatt
cctgctcatgaaaggtctgctcgtggaaagcaaatttgtttatatgttcgctttccacaa
caaaatcggcaaattgaagactttgaagtatggtctcattctaatgaatcaattgcctca
cttcgaagaaggatatatgttcgtttaaaaaatatagttcaagcaataaagttagatatt
tgttataataatgatgttctcaacccaactgatgatcgtaaattaattagcgatttgcca
atcaaagatagaggcgtttttacaataaaattaggttcgtcatccaatagtattccatct
tctcctgattcatcttcagatacttcaccgccacctaccccactatgtggcgatggacct
aatgttgaaacagagcatttattacctagtgttatattgtctaggacaaagtttgttcag
actttgtttactcttggagatttagctatgaagtttcatttggaagaattacaaaacatt
gtccttaatttgttgaacatatgttcttcagatgttgaaacaatcaataatataaaaaca
ttatgtcataacagcatgataaaaggaatgtcttcgttagacaaactattttcaatagtg
acaccaatacaggctctttataatcttgagattatttatgctttattacttcctgcaatg
gaaccattagaaaattacccaataagtttccaacatagtataatattagctgggggcatt
gacagcattctaaatttgtttacaaacaaaacttttttgcatggagcaaatacacttata
aaaagaatggcctacactgtcttattcaaaatatcaaagttatttttgacaactatttgc
tttgcacatattaccgttgttgctgaggccttgcacaaggactctggaaaagatattgct
gtctccagtgcacaacacaactatgctattgttttacaacaagctactcaacacatccca
aatacatactttgaatttgttctaagaagtatatctgtcaagctaggacaagcattaggt
tctagggcaacaaagtacatgcctgacattaattttgtaaaagttgtacaaaagatttgc
tggagtgctgctgcaggcgatgtatctttacaccaaacagatgttattcacattcatcag
ttttttgaaaaacatgaagaattacaaaagtgtgcaagtttagatgattctaatttagct
aaggaagcttttgaagttatgaccattgctctaacattatgccctccaattctagaaaca
ttaatcagggataactcctggcatttatttattgttgacactttgttgctttgcacatcc
agaagtattaactttcaattgcaaaatgcaacaaaaattatggagcaagaacttaaatgg
ttgcgtaatgtccagactgcctacttcagtgtggaatcttcacatgaatcaacagatgat
gttttacttgagggtcatctgggtataataaaagagttgttgcaatatcattctattcaa
aaacgatatcatattggatgtgaagaagggggtgaaaaattaattgagaggctgcttaat
gactttgttttctcctcctcaagatctttgttggcagccagaagaggagtttatctggat
caagttcatccgatgtgtaagacacaacaaacaattgttgctgccctcgagctattaatt
tctcttgcttctaattgtgttcctaaccttcgtcttattgctgaatatttaactcaaatt
tattactctgggtatgatagccctattactgaatgggaatatcaacctccaataggtcct
cgtcctgaaaatggttttgttggattaaaaaatgctggtgctacatgctacatgaattct
gttttgcaacagctttgcatgataccagagattgctagtggagtacttagtgtcgatgtt
ggatataatgaagatgatgacaaccaacacgaaaaaacagttttgaacattgacaatgat
gttacatcatcaagtagtgaaaataaagaacttgttgaaaagaataagcagaaagagcgc
cagcaatataataaaaaagttttatgccaagtgcaagctatttttggtcatttgtatggt
agtaagctgcaatattacattcctcatggtttttggcaagtttttcgtctttggggagaa
cctgttaatttacgagagcagcatgatgcttatgagtttttcaatacacttgttgataat
attgatgaagcattaaaagctcttggtcataatacagtttgttcgaacattttaggagga
tcatttgcagatcaaaaaatttgtaaacaatgtcctcataggtactctcgtgaaacccca
tttactgccattaatgtggatgttcgaaaccatcataatttaattgacagtttagaacaa
tatgtaaaaggagatttacttgagggtgcaaatgcttactattgtgaacgttgtgataaa
aaagttgatacagttaaacgattgtgtatacgaaaactgccaaaagtattagcaatacag
ctcaaacgatttgactatgactgggaaagagactgtgctgtgaagtttaatgattatttc
gagtttccaagagagtttgatttggagccatttactgtagaagggctagctaaattagaa
ggtgaaataattgaagaagatattatagatcaagcaaataagactccatttattgtggat
gatgaaaaagaaaaaagtactatatataaacttgttggggttactgttcacagtggccag
gctagtggaggtcattattactcatatataaccaacagatcaaaatcaagtggaaaacaa
agctggtataaatttgatgatggtgatgttagtgattgtaacatggatgatgaagaggag
cttaaaaatcaatgctttggtggtgaatatatgggagaagtttttgaccatatgatgaaa
aggtttcaatttagacgtcaaaagaggtggtggaatgcttatcttttattttacgaacga
cttgatgttgcatctaaaaccaatcgtgaaaatagttcttcctgtggcaagttaataatg
ccttcagctatagaaaaatcagtttcacaagaaaacattcaatttttgcatacaaaaatg
cagttttctcaagagtactttcagtttatacgcaaattagtgttatcaagtctgtcacca
caagctcattcatcaccacataaacctaacgacccagcccgtgatgagctacattttatt
tgtctccaactcttaagcaagtttctctttactgtatgctttcatactaaaaaaaatata
agaggacctgcaaatgaatggtatgaaactgttgcagtattagttcgccaaagtccttct
ttgcgaagatggtttgttatagaggttttattatcccggccagatagaattattgagtat
cttcttgaatgtcctgttgcagagattcgcagtgcttttgggagaataataattttacta
gctcacttaactcgtaatgatggttgctttagtattgaattgcttaacagtccacttgaa
ccttggcaagtttctgacttagatgccacaaaagctacaataagtgattacttaatgcga
acagttatagaagttcttcatcgtgaaagttcagaaaacaatcctagacatctcctgcag
tactttcaattatttgtcatgtatgcaggaattgggcctgctgagcgtaaacaacttttg
gacttgggagtacttttaacatttattcgtcttgcattagaagaagagtttaataattca
gtcaaataccaaaatgttgaatcagcaaagttatattctttggtgtccgttttaataaga
agctgtgatgtgactaaatatatgaattctgcaataaaaggagagcaatgtaaacctaat
ccatacttagactctatggctaccactccaattatggaaataccctctgatgttgaaggc
atgatttacacaagcaattgcatcaaaaagtttttagaagaaagtaataattccgaagat
acaattcaactaattaagtttttgagttgggaatgtttgagtttttctcttattgcgtta
tcagaggttttattctcaatttcatatgcttacacatatgagcttcgtccttttcttgat
attcttttacatttgctactcatgaatgactcttggcaggagcaaagactcaaatcagct
tttaatggagtatcagatgatcgtgaaggactatttgatacaattcaacgatcaaaatca
catagtcataaacgaggttaccaatgtatcaaagctattgtccaacttattcaaaattgt
gaattagctcatcaaatattaatgaaatcagaagagttaaaagcgaaatggaaaagtgca
ataatttggttgggggaagagttagataggcgggcaccatcagcatacaattacaataat
tggagtccaccaactgcatctaatgaaaattcaaatggatactttttggaaagatctcaa
agcgcaagatttacatatgcaaaagctcgtgagctttttgatgagagtgaagaggaagaa
cctgaagatgaagttgttgaacatcttcctaagcaatacaatgatgagttttcagataat
catcgcccattgcgttactgtggatctgagagtgatgccattcaagttccaaaattatta
tcagatagtgtagtacatttagatatatcaaatgatgcttctttaaatgatgatgagtca
gatagctaa

DBGET integrated database retrieval system