KEGG   Hydra vulgaris: 100206753Help
Entry
100206753         CDS       T01080                                 

Definition
histone acetyltransferase KAT8-like
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
hmg  Hydra vulgaris
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 459 aa AA seqDB search
MIQKMSEKSLNDTEEYTNIKEVLSISEPMLSHDVSYVTHKELNDMSNEVNQYEKLSYKKH
NGEHCFVKRSDSEEWQLSEIIHSRKQADGLIEYYVHYQGCNRRLDEWVPQDRVDRTRSIP
EQEIKPNVDLVSIEGENIDRKITRNQKRKHDEINHVQKSYEEMDPTTAALEKEHEAITRV
KYIDTIEMGKYDIDTWYYSPYPDEYSKQKKLFICEYCIKYMKFEATYRRHLEKCKLRQPP
GREIYRKDSISVYEVDGKDYKIYCQNICLLAKLFLDHKTLYFDVEPFLFYILTEVDKEGA
HMVGYFSKEKDSPEGNNVACILTLPPYQRKGYGKFQIAFSYELSKIEGLIGSPEKPLSDL
GKLSYRSYWTWVLLDVLRTSSGTLSIKDLSVLTSITQEDCIGTLQSLNMVKYWKGQHVIC
VTPRLIEDHLKTFPSKKPPLTVDRVCLLWSPPYKKKMKK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgatacaaaaaatgtcagaaaagagtcttaacgacactgaggaatatacaaatataaaa
gaagtactatcaatatctgaacctatgctaagtcatgatgttagttatgttactcacaaa
gagttaaatgacatgtcaaatgaagtaaatcagtatgagaaactatcctacaaaaagcac
aatggcgagcattgttttgtaaaaagaagtgattcagaagaatggcaactttctgaaata
atacacagtcgaaagcaagctgatggactgatagaatattatgttcactatcaaggatgt
aatagaagattagatgaatgggtacctcaagaccgtgttgatcgaacaagatctatacct
gaacaggaaataaaaccaaatgttgatttagtgtcaattgaaggagaaaacattgatcgt
aaaatcacaagaaaccaaaaacgaaaacatgatgaaattaatcatgtccaaaagagttat
gaagagatggaccctacaacagcagccctggaaaaagaacatgaagctattacacgtgta
aaatatatagacactattgagatgggaaaatatgacattgatacttggtattatagtcca
tatcctgatgaatattcaaaacaaaaaaagttgtttatttgtgaatattgcattaaatat
atgaagttcgaagcaacatacagacgtcatttggaaaagtgtaagttgcgtcaaccacct
ggtcgagaaatttatcgcaaagattctatttctgtttatgaggttgatggtaaagactac
aaaatctactgccaaaatatatgtctacttgctaaactgtttcttgatcacaaaacgctt
tattttgacgttgagccattccttttctatattctaacagaggttgataaagaaggggca
catatggtgggatatttttcaaaggagaaagattcacctgaaggtaataatgtggcttgt
attttaacactgccaccatatcaacgaaaaggttatggaaaatttcaaattgcatttagc
tatgagttatcaaaaattgaaggactaattggatctccagaaaagccgttatctgatctt
ggcaaattaagctacagaagttactggacatgggttttactagatgttctgcgaacctca
tcaggcactctatcaataaaggatttaagtgttttaaccagtattacacaagaagattgc
attggtacattacagtccttaaatatggtgaagtattggaaaggtcagcacgtcatatgt
gttactccgaggcttattgaagatcatttaaaaacatttccgtcaaaaaaaccaccactt
actgtagatcgtgtttgcttactttggtctccgccatacaaaaagaaaatgaaaaagtag

DBGET integrated database retrieval system