KEGG   Hydra vulgaris: 100206915Help
Entry
100206915         CDS       T01080                                 

Definition
histone deacetylase 11-like
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
hmg  Hydra vulgaris
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 237 aa AA seqDB search
MHKSQLYKDIPYEKVPIIYNSMYNISFFGMEKLHPFDSGKWGRIIKMLVDESVIKKEEII
DSEQISETELLLVHTKDYLQSLKSSFTVARITEIWPVALLPHFIVNRNLLIPFKFQTGGT
VLAAKVAMERGWAINIGGGFHHCSSSEGGGFCAYADITLAIKILKNEFDAVRNIMIIDLD
AHQGNGHERDFIDKSVYIMDAYNAYIYPSDSSAEAAISRIIKLKPYTEDKEYLELIK
NT seq 713 nt NT seq  +upstreamnt  +downstreamnt
atgcataaatcacaactttacaaagatatcccttatgaaaaagttcctattatatataac
tcaatgtacaacatctctttctttggtatggaaaagcttcatccatttgactctggaaaa
tggggtagaattattaaaatgcttgttgatgagtctgttataaaaaaagaagaaattatt
gattcagagcaaatcagtgaaacagagttattgcttgttcatactaaagattacttgcaa
agtctaaaatcaagttttacagttgctagaattacagaaatttggcctgttgcacttttg
ccgcattttattgtaaatcgtaacttacttattccttttaaatttcaaacaggtggaact
gttttagctgcaaaagtagcaatggaaagaggttgggctattaatattggagggggtttt
catcattgttcgagtagcgaaggaggtggtttttgtgcatatgctgatataacattagca
attaagatattaaaaaatgaatttgatgctgttaggaatattatgattatagatcttgat
gctcatcaaggcaatggacatgaaagggattttattgataaaagtgtatacattatggat
gcttacaatgcatacatttatcccagtgatagctctgctgaagctgcaatatcaagaatc
attaaacttaaaccttatacagaggacaaagaatatttggaacttattaaaag

DBGET integrated database retrieval system