KEGG   Hydra vulgaris: 100207067Help
Entry
100207067         CDS       T01080                                 

Definition
histone H2B.2, sperm-like
Orthology
K11252  
histone H2B
Organism
hmg  Hydra vulgaris
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 159 aa AA seqDB search
MAGSPKKGSPRKASPKRGGSPKKTSPRKASPHRSSRPASPNKKAHKGKKAIKAIHKKNKK
SHHRRKGKQSYGIYIYRVLKQVHPDVGISSKAMSIMNSFVNDIFERIAGESSKLAVHNKK
MTISSREVQTSVRLILPGELAKHAVSEGTKAVTKYSSSK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggccggaagtccaaagaaaggtagtcctagaaaagcaagtcccaaaagaggcggaagt
cctaaaaagaccagtcctagaaaagcaagccctcatcgatcatcgagacctgctagcccg
aataagaaagctcataaaggtaaaaaagcaattaaagctatacataagaaaaacaagaag
agtcatcaccgacgaaaaggaaagcaaagttatggcatctatatttacagagtgcttaag
caagttcatcctgatgttggaatttcaagcaaagctatgagcataatgaattcattcgtc
aacgatatttttgagcgaattgcgggagaatcgtcaaaacttgcagtgcacaataagaaa
atgaccatttcttcacgcgaagttcaaacatcagtgcgtctcattcttccaggagagctt
gcaaaacatgctgttagtgaaggaacaaaagctgttacaaagtattcaagttcaaaataa

DBGET integrated database retrieval system