KEGG   Hydra vulgaris: 100207538Help
Entry
100207538         CDS       T01080                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 2-like
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
hmg  Hydra vulgaris
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 586 aa AA seqDB search
MRIMLTVSRQQFNPLKSEISMTGSKAIAHPEVKNFKAESVPLKTTNKYTNINNKFTQENG
NYGLPQLASLHVQQLYDDDDDNNVNKMKNEKRPLPTVNGNNNNNNASSPTERQSSMSVLS
ESTKSKVTPMTPEQAMKLFMHKLTTFEHHEIFNFPQIYFVGPSSKKRQGIVGGSNNNGYD
DDQGSYVLTPHDQINYRYEVLKVIGKGSFGSVIKAYDHKAQINVALKIIRNEKRFHRQAA
EEIRILEHLRKQDKENNFNIIHMLEHFQFRNHICITFELLSINLYELIKKNKFQGFSLQL
VRKFAHSMLQCLESLYRNRIIHCDLKPENVLLKQQGRSGIKVIDFGSSCYEHQRIYTYIQ
SRFYRAPEVILGARYGMPIDMWSFGCILSELLTGYPLFPGEDESDQLACVIELLGVPPEK
LLGNSKRAKNFISSKGYPRYCSVTTLPDGSTVLTGGRSRHGKVRGPPNSKDFVTALRGCD
DPFFIDFLKKCLDWEPSQRLIPSQALRHPWLRRRLPRAPVDPNTITNNQHISEKNKQNRQ
QSAVSISKLPPAQPPSSKHTRRTSENQSDQGSELNRHTILPKIIGR
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattatgttaactgtatcacgtcaacaattcaatcctttaaagagtgaaatatcg
atgactggatcaaaagcgattgctcatcctgaggtgaaaaattttaaagctgaatctgtt
ccactaaaaacaactaacaaatatacaaatataaataataagtttactcaagaaaatggc
aattatggcttgcctcagctagcttctctccacgttcaacagctttacgatgacgatgat
gataacaatgtcaataaaatgaaaaatgagaaacgtccgttgcctacggtaaatggtaac
aacaacaacaataatgctagtagtccaaccgaacgccagtcaagcatgagtgtattatca
gaatctacgaaatcgaaggttacccctatgactcctgaacaagcaatgaaactatttatg
cataaactgacaacatttgagcatcatgaaatttttaattttcctcaaatatactttgtg
ggtccaagttcaaaaaaacgccaaggaattgttgggggttcaaataacaatggttatgac
gatgatcaaggatcttatgttttgacaccacatgatcaaattaattatcggtatgaagtt
ttaaaagtcattggtaaaggtagttttggttctgtcataaaagcttatgatcataaagct
caaattaatgttgcattgaaaataatacgtaatgaaaaacgatttcatagacaagctgct
gaagaaataaggatattagagcatttacgcaaacaagataaagagaacaattttaatata
atacatatgcttgaacattttcagtttcgcaatcatatatgcattacatttgaacttctt
agtataaatctttatgaacttataaaaaagaataaatttcagggattctctttacagctt
gtacgaaagtttgctcattctatgctacagtgtttagaatctctttatcgtaacagaata
atccattgtgatttaaaacctgaaaatgttttgttaaagcagcaaggtcgcagtggaatc
aaagttattgattttggctccagttgctatgaacatcaaagaatttatacttatattcaa
tcaaggttttacagagcaccagaagttattttaggtgcgcgatatgggatgccaatagat
atgtggagttttggttgtatattatctgaacttttaactggctatcctttatttcccgga
gaagatgaaagtgatcagctagcgtgtgttattgaactattaggtgttccaccagaaaaa
cttttaggaaactcgaaacgagctaaaaattttatcagttctaaaggataccctagatat
tgttcagttacaacattacctgatggaagtacagttttaacagggggacgttcgagacat
ggtaaagttagaggtccgcctaattcaaaagactttgtcactgcattaagaggatgtgat
gaccctttttttattgactttttaaaaaaatgtttagattgggagccaagtcaaagattg
attccctcacaagcattacgacacccctggttacggcggagattacctcgagctcctgtt
gatcctaataccataacaaacaatcaacatataagtgaaaaaaataagcaaaatagacag
cagtctgctgttagcataagcaaacttcctcctgctcaacctccttcatctaaacataca
agaagaacttcagaaaatcaatcagaccaaggttctgaattaaacagacatacaatatta
ccaaaaattataggaagatag

DBGET integrated database retrieval system