KEGG   Hydra vulgaris: 100207889Help
Entry
100207889         CDS       T01080                                 

Definition
creatine kinase M-type-like
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
hmg  Hydra vulgaris
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hmg00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 447 aa AA seqDB search
MDINLKLVIGAGLSSGLLFGYCASRFFFSSKSNVKKRYKVESNAKEIETQTEENVLLSRS
LETFSNDLTYNANENFPNLRDNRSFMARYLTKKIYSDLYNRRTPLGFTIDKVLQAALDNP
NKGGCGIVAGDEYCYEVFAPVFDPVIAERHEGFKRKRDMTTVLDQESPSQVSIERPIQHL
YERPFDSKLVKSSYFLISRCLSGFRFSPSCSRAERNHIELQLKTALLALTGDYKGTYIHL
AEMTTEIKSSLPDILQTASNTAFGRTLSSRGEFHDWPFGRGVFYNSELTLMAWVNFEDHL
RIMYRSEDSNFKDSYKKFQSAIRELEEKLLEVNITFAFHPEYGYLLSCPSAIGTTLIAVA
SVKLPRTIRHDRFRDIARNLRIHIRAKDRDALKKGWVDVYNKDRLGFTEEELLHQVADAV
HKLCEIETNLENDGSFSDLLSYRSILQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggatataaatttaaaattagttattggtgctggattaagttctggcttgttattcggc
tattgtgccagtcggttctttttttcttcaaaatctaatgtgaaaaaaaggtacaaagtg
gaatcaaacgcaaaagaaattgaaacccaaacggaagaaaatgttttattatcacgtagt
ttagaaacgttttcaaatgatcttacatacaacgcaaatgaaaattttccgaatcttcga
gacaatagatcgtttatggctcgttatttaactaagaaaatttacagtgatttgtacaac
cgaagaactcctttgggttttacaattgataaagtactacaagcggctttagataatcca
aataaaggtggttgcggaattgtagctggcgatgaatattgctatgaggtttttgcaccg
gtgtttgacccggttatcgctgagcgacacgaagggtttaagcgaaaacgcgacatgaca
actgttttagatcaagaaagtccgagtcaagtttcgatagaacgtccaattcaacacctg
tacgaacgtccatttgactcaaaactcgtcaaatcgtcatactttttaatttctcggtgc
ttaagcggatttagattttcaccgtcgtgcagtcgagcggaaagaaatcatatagaactt
caattgaaaacagcattgttagcattaacaggagattataaaggtacttacatccactta
gctgaaatgacaaccgaaattaaatcttctttgccagatatattacaaacagcttcaaac
acagctttcggtcgcacattgtcgtcgcgtggagagtttcatgattggcctttcgggaga
ggtgttttctataattctgaactaacccttatggcgtgggtgaactttgaagatcatttg
cgtataatgtatcgcagtgaagattcaaattttaaggactcttataaaaaatttcaatct
gccatacgcgaacttgaagaaaagttgttagaggtcaatattacttttgcttttcatcca
gaatatggttatttgttgtcatgcccaagtgcaattgggactactttaattgcagtagcg
tccgttaaacttccaagaactattaggcacgataggtttcgtgatatagcacgaaatttg
cgaatacatattcgagcgaaagaccgagatgcattaaaaaaaggatgggtagatgtatac
aataaagatcggcttggttttacagaggaagagcttcttcatcaagttgccgacgctgtt
cacaaattatgtgaaatcgaaacaaacttagagaacgacggctcattttcagatttactt
agttatagaagtattcttcaataa

DBGET integrated database retrieval system