KEGG   Hydra vulgaris: 100207889Help
Entry
100207889         CDS       T01080                                 

Definition
(RefSeq) creatine kinase B-type-like
  KO
K00933  
creatine kinase [EC:2.7.3.2]
Organism
hmg  Hydra vulgaris
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100207889
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     100207889
Exosome [BR:hmg04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   100207889
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 205 aa AA seqDB search
MTTEIKSSLPDILQTASNTAFGRTLSSRGEFHDWPFGRGVFYNSELTLMAWVNFEDHLRI
MYRSEDSNFKDSYKKFQSAIRELEEKLLEVNITFAFHPEYGYLLSCPSAIGTTLIAVASV
KLPRTIRHDRFRDIARNLRIHIRAKDRDALKKGWVDVYNKDRLGFTEEELLHQVADAVHK
LCEIETNLENDGSFSDLLSYRSILQ
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgaaattaaatcttctttgccagatatattacaaacagcttcaaacacagct
ttcggtcgcacattgtcgtcgcgtggagagtttcatgattggcctttcgggagaggtgtt
ttctataattctgaactaacccttatggcgtgggtgaactttgaagatcatttgcgtata
atgtatcgcagtgaagattcaaattttaaggactcttataaaaaatttcaatctgccata
cgcgaacttgaagaaaagttgttagaggtcaatattacttttgcttttcatccagaatat
ggttatttgttgtcatgcccaagtgcaattgggactactttaattgcagtagcgtccgtt
aaacttccaagaactattaggcacgataggtttcgtgatatagcacgaaatttgcgaata
catattcgagcgaaagaccgagatgcattaaaaaaaggatgggtagatgtatacaataaa
gatcggcttggttttacagaggaagagcttcttcatcaagttgccgacgctgttcacaaa
ttatgtgaaatcgaaacaaacttagagaacgacggctcattttcagatttacttagttat
agaagtattcttcaataa

DBGET integrated database retrieval system