KEGG   Hydra vulgaris: 100207986Help
Entry
100207986         CDS       T01080                                 

Definition
chitooligosaccharidolytic beta-N-acetylglucosaminidase-like
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
hmg  Hydra vulgaris
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hmg00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:hmg00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:hmg00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:hmg00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:hmg00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:hmg04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 632 aa AA seqDB search
MIGVGVLLWLILATTHAQQKCSRKNSVWTWVCQKNTCVKVDSEPFESTVELDTCKLTCGS
SSMLFPKPSGKATFGNETVSFFPTKILLNKMLCASKVCDPKNTFYINAAFNRFQNQIQET
YTRLSKVPTIANDINACIDETKNRQFLVTINVKSKYERLTLETDESYSLAITSSSKQIDA
VITAKTFFGARHGLETISQLTAYLRSHNSMQVVNNVNIVDDKPAYKYRGLMLDTSRNYFS
VDSILRLITAMSYNKMNTLHWHITDTHSFPIEIKSVPQLLQYGSYSPSRIYTHLDVRKIV
DHAAVHGVRVLPEFDQPAHCGEGWEWGPKAGLGNLAVCVDKEPWQKYCVEPPCGQLNPTN
DQLYNVLGKIYKEYFDLFNPDIFHAGGDEININCWNTTSEITDWLHKNYKGVGENEFMKM
WGMFLQKSSQKIFEANENKELPLILWTSKMTSIKYLNKYMDPKKHIVQIWTASTDNELQS
IVESGFKTIFSTYDTLYLDCGYGNWLVEGNNWCSPYKDWKLLYGNDPVRILKSFNVTVTH
KIKDSILGQESAMWSEQVDEYTSEGKIWPRTAALAERLWTNPSHDWRDAEYRLIFHRERL
VERGIQADALQPLWCLQNAGHCYYDSNIQGEH
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgattggagtaggtgttttgctttggctcatacttgctacaacccatgcacagcaaaag
tgttccagaaaaaactctgtctggacttgggtttgtcaaaaaaatacgtgtgtgaaggtg
gattctgaaccatttgaaagtacagttgaacttgatacctgtaagttgacatgcgggtct
agttctatgctctttccgaaaccatctggcaaagcaacatttggaaatgaaacggtttca
ttctttcctactaaaattcttcttaacaaaatgttatgcgcatcaaaagtatgtgatcca
aaaaacactttttatattaatgcagcctttaacagatttcaaaatcaaattcaggagact
tatactcggttgagcaaagttccaaccattgctaacgatatcaacgcttgcattgacgaa
acaaagaatcgacaatttttagttaccataaatgtaaaatcgaaatacgaacgtttaaca
ttggaaacagatgaaagttattcccttgctatcacatcttcaagtaaacagattgacgca
gtgattactgcaaaaacattttttggtgcacgtcatggccttgaaacaataagtcaactt
actgcttatcttcgatcccataattcaatgcaagttgtaaacaatgtaaacattgttgac
gacaagcctgcatataaatatagaggacttatgctagacactagcagaaactacttttct
gttgacagtatattgcgtttaattacagctatgtcttataacaaaatgaacacgcttcat
tggcatattactgatacgcacagttttccgattgaaattaagtctgtgccacaacttctt
cagtatggttcatatagcccatcgcgtatttatactcatttggatgtacgtaaaatagtt
gatcatgcagcagttcacggagtccgagttttaccagagtttgatcaaccggctcattgc
ggtgaaggatgggaatggggtcctaaagctggtcttggcaatttagcagtgtgcgttgac
aaagaaccctggcaaaagtactgcgttgaaccaccttgtggacagttgaaccctacaaac
gatcagttgtataatgtacttggaaaaatttataaagaatatttcgacttgtttaaccca
gatattttccatgctggtggagatgagattaatataaattgttggaatacaacgtcagaa
ataactgattggttacacaagaattacaaaggagttggggaaaacgagtttatgaaaatg
tggggaatgtttctacagaaatcatctcaaaagatttttgaagccaatgaaaataaagag
cttccattaattctgtggacaagtaaaatgacgtcaataaagtatttaaataaatatatg
gatccaaaaaaacacatcgttcaaatttggacagcatcgactgataatgagcttcaatca
attgttgaaagcggatttaaaacaatattttctacttatgatacattatacctggattgc
ggttacggaaactggttagttgagggtaacaactggtgttcaccatacaaagattggaaa
cttttatacggtaacgatcctgttaggatacttaaatcatttaacgtcacagtgactcat
aaaataaaagacagtatattgggtcaagagtctgctatgtggtctgaacaggttgatgaa
tatacgtccgagggaaaaatatggccaagaacagctgcacttgctgaacgactttggacg
aacccatcacacgattggcgtgatgctgaataccgattaatttttcaccgagaaagatta
gttgaaagaggaatccaagcagatgctttgcaacctttatggtgtttacaaaatgctggt
cattgctattatgactcaaatattcagggagaacactaa

DBGET integrated database retrieval system