KEGG   Hydra vulgaris: 100207986Help
Entry
100207986         CDS       T01080                                 

Definition
chitooligosaccharidolytic beta-N-acetylglucosaminidase-like
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
hmg  Hydra vulgaris
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100207986
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100207986
   00603 Glycosphingolipid biosynthesis - globo series
    100207986
   00604 Glycosphingolipid biosynthesis - ganglio series
    100207986
   00511 Other glycan degradation
    100207986
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100207986
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100207986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 632 aa AA seqDB search
MIGVGVLLWLILATTHAQQKCSRKNSVWTWVCQKNTCVKVDSEPFESTVELDTCKLTCGS
SSMLFPKPSGKATFGNETVSFFPTKILLNKMLCASKVCDPKNTFYINAAFNRFQNQIQET
YTRLSKVPTIANDINACIDETKNRQFLVTINVKSKYERLTLETDESYSLAITSSSKQIDA
VITAKTFFGARHGLETISQLTAYLRSHNSMQVVNNVNIVDDKPAYKYRGLMLDTSRNYFS
VDSILRLITAMSYNKMNTLHWHITDTHSFPIEIKSVPQLLQYGSYSPSRIYTHLDVRKIV
DHAAVHGVRVLPEFDQPAHCGEGWEWGPKAGLGNLAVCVDKEPWQKYCVEPPCGQLNPTN
DQLYNVLGKIYKEYFDLFNPDIFHAGGDEININCWNTTSEITDWLHKNYKGVGENEFMKM
WGMFLQKSSQKIFEANENKELPLILWTSKMTSIKYLNKYMDPKKHIVQIWTASTDNELQS
IVESGFKTIFSTYDTLYLDCGYGNWLVEGNNWCSPYKDWKLLYGNDPVRILKSFNVTVTH
KIKDSILGQESAMWSEQVDEYTSEGKIWPRTAALAERLWTNPSHDWRDAEYRLIFHRERL
VERGIQADALQPLWCLQNAGHCYYDSNIQGEH
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgattggagtaggtgttttgctttggctcatacttgctacaacccatgcacagcaaaag
tgttccagaaaaaactctgtctggacttgggtttgtcaaaaaaatacgtgtgtgaaggtg
gattctgaaccatttgaaagtacagttgaacttgatacctgtaagttgacatgcgggtct
agttctatgctctttccgaaaccatctggcaaagcaacatttggaaatgaaacggtttca
ttctttcctactaaaattcttcttaacaaaatgttatgcgcatcaaaagtatgtgatcca
aaaaacactttttatattaatgcagcctttaacagatttcaaaatcaaattcaggagact
tatactcggttgagcaaagttccaaccattgctaacgatatcaacgcttgcattgacgaa
acaaagaatcgacaatttttagttaccataaatgtaaaatcgaaatacgaacgtttaaca
ttggaaacagatgaaagttattcccttgctatcacatcttcaagtaaacagattgacgca
gtgattactgcaaaaacattttttggtgcacgtcatggccttgaaacaataagtcaactt
actgcttatcttcgatcccataattcaatgcaagttgtaaacaatgtaaacattgttgac
gacaagcctgcatataaatatagaggacttatgctagacactagcagaaactacttttct
gttgacagtatattgcgtttaattacagctatgtcttataacaaaatgaacacgcttcat
tggcatattactgatacgcacagttttccgattgaaattaagtctgtgccacaacttctt
cagtatggttcatatagcccatcgcgtatttatactcatttggatgtacgtaaaatagtt
gatcatgcagcagttcacggagtccgagttttaccagagtttgatcaaccggctcattgc
ggtgaaggatgggaatggggtcctaaagctggtcttggcaatttagcagtgtgcgttgac
aaagaaccctggcaaaagtactgcgttgaaccaccttgtggacagttgaaccctacaaac
gatcagttgtataatgtacttggaaaaatttataaagaatatttcgacttgtttaaccca
gatattttccatgctggtggagatgagattaatataaattgttggaatacaacgtcagaa
ataactgattggttacacaagaattacaaaggagttggggaaaacgagtttatgaaaatg
tggggaatgtttctacagaaatcatctcaaaagatttttgaagccaatgaaaataaagag
cttccattaattctgtggacaagtaaaatgacgtcaataaagtatttaaataaatatatg
gatccaaaaaaacacatcgttcaaatttggacagcatcgactgataatgagcttcaatca
attgttgaaagcggatttaaaacaatattttctacttatgatacattatacctggattgc
ggttacggaaactggttagttgagggtaacaactggtgttcaccatacaaagattggaaa
cttttatacggtaacgatcctgttaggatacttaaatcatttaacgtcacagtgactcat
aaaataaaagacagtatattgggtcaagagtctgctatgtggtctgaacaggttgatgaa
tatacgtccgagggaaaaatatggccaagaacagctgcacttgctgaacgactttggacg
aacccatcacacgattggcgtgatgctgaataccgattaatttttcaccgagaaagatta
gttgaaagaggaatccaagcagatgctttgcaacctttatggtgtttacaaaatgctggt
cattgctattatgactcaaatattcagggagaacactaa

DBGET integrated database retrieval system