KEGG   Hydra vulgaris: 100208060Help
Entry
100208060         CDS       T01080                                 

Definition
(RefSeq) 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase-like
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
hmg  Hydra vulgaris
Pathway
hmg00270  Cysteine and methionine metabolism
hmg01100  Metabolic pathways
Module
hmg_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    100208060
Enzymes [BR:hmg01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     100208060
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     100208060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_1 Cupin_3
Motif
Other DBs
NCBI-GeneID: 100208060
NCBI-ProteinID: XP_002165167
UniProt: T2M5T7
Position
Un
AA seq 186 aa AA seqDB search
MVKIWLMDQSSENPYLTHKRNPNVALPVDEISKLGVFYKKMKTEDYEEGDKYLDDPELIS
LRNEKNYSYCDFITVSEKDLPNYEEKIKLFFQEHTHTDDEIRYIIDGSGYFDVKNQKSEW
VRIFVSKGDLLSLPAGMYHRFTVDENKYIKVIRFFIGEPVWTPIYLPQSDNLPERKEYIR
KYLESS
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaatttggttaatggatcaatcttctgagaatccttatttaactcataaaaga
aatccaaacgtagcgttacctgttgatgaaatttccaagttaggtgttttctacaaaaaa
atgaaaactgaagactatgaagaaggtgataagtatttggatgacccagaactgatttct
ttacggaatgaaaaaaattattcttactgcgattttattactgtctcagaaaaagatttg
ccaaattatgaagaaaagattaaattgttttttcaagagcatacccacactgatgatgaa
attcggtatatcattgatggtagtggatactttgacgtaaaaaatcaaaagtctgaatgg
gttcgaatttttgttagtaaaggagatctgttaagcttgccagctggtatgtatcatagg
tttacagttgacgaaaacaagtacataaaagtaattcgcttttttattggagaacctgtt
tggactccaatatatttacctcagtctgataacctaccagaaagaaaagaatatattaga
aagtatcttgaatcatcatga

DBGET integrated database retrieval system