KEGG   Hydra vulgaris: 100208326Help
Entry
100208326         CDS       T01080                                 

Definition
alanine aminotransferase 2-like
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
hmg  Hydra vulgaris
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100208326
   01210 2-Oxocarboxylic acid metabolism
    100208326
   01230 Biosynthesis of amino acids
    100208326
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100208326
Enzymes [BR:hmg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     100208326
Amino acid related enzymes [BR:hmg01007]
 Aminotransferase (transaminase)
  Class I
   100208326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 437 aa AA seqDB search
GKKLPFETIIKAYVGDCHAMGQKQITFVRQLLAACLYPPLINKNIFPSDVNKRANKILST
IKESMGCYGDIGGLAVVKKNVAKFIARRDGLLCNSEHIVLTNGASTSVQYILELFVRENE
NVGIMIPIPQYPLYSATIDEFGMKQVGYYLNEENNWSLDISELKRSLDDARKTCSVKCLC
VINPGNPTGQVLSYQNIQEIIKFAIEEGLFIIADEVYQDNVYAEECTFYSFKKVMKEMGN
VAKDLQLASLHSCSKGFLGECGLRGGYVEFVGISDEVCYHFNKLLFAQTSTNVTGQLVLY
CFVNPPKNHESSYDLFVQEKTNILSSLKKRARLVYENLNKIEGVICKEIQGSLFAFPQIW
LPEKAINQAKSLGQAPDFFYCMQLLEQTGICVVPGSSFHQKDGTYHYRLTILPSDDQLKA
LLKKFGEFHKRFLNFYK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
ggaaaaaaacttccatttgaaacaataattaaagcatatgttggtgattgccatgcaatg
ggacaaaaacaaattacatttgttcggcagcttcttgctgcatgtttatatcctccatta
attaacaaaaatatctttccttctgatgtaaacaaaagagcaaataaaattctaagtact
atcaaagaaagcatgggttgctatggtgatattggtggtttggctgttgttaaaaagaat
gttgcaaagtttattgctcgtcgagatggtttactttgtaattcagaacatatagttctc
acaaatggcgctagtacatctgtccaatacatcttagagttatttgttcgtgaaaatgaa
aatgttggcatcatgattccaattccacaatatccactgtattctgcaactattgatgag
tttgggatgaagcaagtaggatactatttaaatgaagaaaacaattggtcgttagatata
tcagagttaaagcgttctttggatgatgcaagaaaaacatgttctgtaaaatgtctttgt
gtaataaatcctggtaatccaactgggcaagttctttcttatcaaaacattcaagagata
atcaagtttgcaatagaagaaggtttatttattattgctgatgaagtttatcaagataat
gtttatgctgaagaatgtaccttttattcttttaaaaaggtaatgaaagagatgggaaat
gttgctaaagatttgcagttagcatctctacattcttgctcaaaaggttttttgggagaa
tgtggtttgagaggaggatatgttgaatttgttggcatcagtgatgaagtttgttatcac
tttaataaattactttttgcgcaaacgagtaccaacgtaacaggacagttagttttgtat
tgttttgttaatccacctaaaaatcatgaatcttcatatgacttgtttgtacaggaaaaa
acgaatattctgtcatctttgaaaaaacgagcccgattggtgtatgaaaatttaaacaaa
atagaaggtgttatctgcaaagaaattcagggatctctttttgcttttcctcaaatttgg
ctacctgaaaaagctatcaaccaagcaaagtcacttggtcaagctcctgattttttttat
tgcatgcaactacttgaacaaacaggaatatgtgtggtgccaggtagtagttttcatcaa
aaggatggtacctatcattatcgtttgaccattcttccgtcagatgatcaattaaaagct
ttgttgaaaaagtttggagaatttcataaaagatttcttaatttttacaaataa

DBGET integrated database retrieval system