KEGG   Hydra vulgaris: 100208416Help
Entry
100208416         CDS       T01080                                 

Definition
protein O-mannosyl-transferase 2-like
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
hmg  Hydra vulgaris
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100208416
Enzymes [BR:hmg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     100208416
Glycosyltransferases [BR:hmg01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   100208416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 643 aa AA seqDB search
MLLAMAGWVTGYNGQFPFDKPGDQYGEHNYVGMRVFCAILGGSCIPLAYLIVWELTHSLP
ACILAACLIIFDNGCVTISQYILLDPILMFFMMMSVFSLMKFYSWRDCPFSFDWWGWMLC
TGYFLACTFSVKWVGLFVILFVGLTTIHDMWQLLGDLTLPIMTILKHFLARVIGLIILPI
TVYLFFFGLHFQSLPYSGPGDGFFSSSFQSTLQGNQLYRARLPGELAYGAVVTLKNYKTA
GVLLHSHHHLYPKEHPPEQQQITGYSHKDSNNDWMVHKPNKLYNESDPVEYVYDGDIVVL
QHVMTKRNLHSHREKAPISKNLQQVSGYGENGVGDANDYWRIEIYKNPGKNGRVSTVKTV
FKLIHVNTKCALQETDQLLPKWGWEQREMACNPNRFATGTTWNVEGNVHKKVPEVSIELL
APSFLESVYESHVVMLQTNNGFKPKEGEFTSQAWHWPINYRGQAFSGGDERIYLLGNPII
WWFILSLFFVYVFLFFTYSVVLRRGYQIHPQLKTSMGVPSLSSSSVDDQYKGIMQLLDEY
GIKSNFSRLCFDTTAINTGITKETVNRVTHDLSKYILRLACRHHVTELRISHFQKQVTHE
EKAGTVVQKTATDALEYCKKYIKKKNIAKEDRKELAELVIIYL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgttgctggcaatggcaggttgggttactggttataatggccaatttccatttgataaa
ccaggagaccagtatggagaacataattatgttggtatgagagttttttgtgcaatactt
ggaggaagttgcatacctttagcatatcttatagtttgggagctaactcattctttacct
gcatgtattttagctgcttgtttgattatttttgataatggttgtgttacaatatctcag
tatattcttcttgacccaattctaatgttttttatgatgatgtctgtattcagcctcatg
aagttttacagctggagggactgtccattttcatttgattggtggggttggatgctttgt
acaggctactttttagcatgcacatttagtgttaaatgggttggattatttgtaattctt
tttgttggacttactacaattcatgatatgtggcagttacttggtgatcttaccttacct
attatgacaatcttgaaacattttcttgctcgtgtaattggtttaataattcttccaatt
acagtttatttatttttttttggtttgcactttcagtcactaccatatagtggaccagga
gatggtttttttagttcttcttttcaatctactttgcaaggaaatcaactgtatagagca
cgattgcctggggaacttgcatatggcgctgttgtaacgctaaaaaactacaaaacagct
ggagttctgctgcactcccatcatcatctttatccaaaagaacatccaccagagcagcaa
caaattactggctattcacacaaagattctaataatgactggatggttcataagcctaat
aagctatacaatgaatccgatcctgttgaatatgtttatgatggtgacatagttgttttg
caacatgtaatgactaaaagaaacttacattctcatagagaaaaagctcccattagcaaa
aatttacaacaagtatctggttatggagagaatggagttggtgatgcaaatgattattgg
cgtattgaaatttacaaaaatccagggaaaaatggacgtgtaagcacagttaaaactgtg
tttaagctgatacatgttaatacaaaatgtgctttgcaggaaacagaccaactgttgcca
aaatggggttgggaacaaagagagatggcatgcaatccaaacaggtttgctactggaact
acttggaatgtggaaggaaatgtgcataaaaaagttcctgaggtaagcatcgaactactt
gcaccatcatttttggagagtgtttatgagtcacatgtggtcatgttgcagactaataat
ggttttaaaccaaaagagggggaattcacatctcaagcatggcattggcctattaactac
agaggacaagcattttctggtggagatgaacgcatctatcttcttggaaaccctattatt
tggtggtttatcttgtcattgtttttcgtatatgtctttctttttttcacatattctgtt
gttctaagaagaggatatcagatacacccccagctcaaaacatctatgggtgtgccttct
ttatcgtcctcttcagtagatgatcaatataaaggaataatgcagttgctagatgaatat
ggtattaaatcaaattttagtagattgtgctttgacacaacagcaataaatactggcatt
acgaaagagaccgttaatagagttacccatgatttaagtaaatacattctccggcttgct
tgcaggcaccatgttacagagcttagaataagtcattttcaaaaacaggttactcatgaa
gaaaaggctggtactgtagtccagaaaacagcaacagatgcactggaatattgcaaaaaa
tacattaaaaagaaaaatattgccaaggaagacagaaaagaactagcagagcttgttatt
atttatttatag

DBGET integrated database retrieval system