KEGG   Hydra vulgaris: 100208539Help
Entry
100208539         CDS       T01080                                 

Definition
(RefSeq) NADPH--cytochrome P450 reductase-like
  KO
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     100208539
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 503 aa AA seqDB search
GLNFTVFSLGNKTYEHYQFFGRYVDKRLEELGGNRVVDRGEGDDDSNIEEDFLIWRDKFW
ESVCNFYGCKNIGLSQTASRDFKLETFPMPFVGQIFKGEITKLGALDKQQPPFDIKNPYM
AKVVVNRELHKGGNRSCMHIEFDINQSGPGFQVTFRNTNDTELVEKLGDLLGVNLDDIFS
LNNIDLEASKKHPFPCPTSIRNALLYYVDITSIVKLHVLQEFIQYTTAETDLAILKKLCD
SSPDGKHFYNEWIVNSYRNIISVLEDLPSCKPPFDLVLEMLPRLQCRYYSISSSPKLSKN
RIHITAVVVDWITPTGRRQKGVATNWLKSISPELNLKVPLFVRQTTFRLPSKCRTPIMMV
GPGTGLAPFRGFIQERQMMLESGMSLGLAFLYFGCRKESEDYIYAEELSSYVQSGAITKL
SVAFSRDQAEKVYVTHKIKENLGSVWQLIKDGGHIYVCGDAKIAKEMQNLIIEAIIQGGK
SNELAKSLMHNLSNTGRYSVDVW
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
ggtttaaactttaccgtgttttcacttggaaataaaacctatgaacattatcaatttttc
ggaagatatgttgacaaacgtctagaagagttaggtggaaatcgtgttgttgacagaggg
gaaggagatgacgactcaaacattgaagaagattttttaatatggagagataaattttgg
gaaagtgtgtgcaatttttatggttgcaaaaatattggactttcacaaactgcatcaaga
gattttaaacttgagacgtttccaatgccttttgtgggtcaaatatttaaaggtgaaata
acaaaacttggtgcattagataaacagcaacctccttttgatattaaaaatccgtatatg
gcaaaagtagttgttaatagagaattgcataaaggtggaaatcgatcatgtatgcacatt
gaatttgatataaatcaatcaggtccaggatttcaagtaacttttcgtaatacaaatgat
acagaacttgttgaaaaacttggtgacttactcggtgttaatttagatgatatcttttca
ttaaacaatatagatttagaagcttctaaaaaacatccatttccttgtccaacatctatt
agaaatgcacttctttattatgttgacataacaagcatagttaaacttcatgttcttcag
gaatttattcaatacactacagcagaaactgatttagctattctaaaaaagttatgcgat
tctagtccagatggaaaacatttttacaatgaatggattgtaaacagttatcgtaatatt
ataagtgttttagaagacttgccatcgtgcaaacctccttttgatttagtattagaaatg
ttaccacgtttacagtgtcgttactattcaatttcatcatctcctaagttatcaaaaaat
cgtattcatataactgccgtagttgtagactggattacaccaactggccgtcgacagaag
ggtgtggcaactaattggttgaaatcaatcagcccggaacttaatcttaaagttccgtta
tttgttcgtcaaactactttccgacttccgtccaagtgccgcacccctataatgatggtt
ggccctggaacaggattagctccatttcgtggttttatccaagagagacaaatgatgtta
gaaagtggaatgtcccttggtttggctttcttatattttggttgcagaaaagaatccgaa
gactatatttatgccgaagaattgtctagttatgtccaaagcggtgctataacaaaatta
tcagttgcattttccagagatcaagctgaaaaggtttacgtaacacataaaataaaagaa
aatcttggatcggtttggcagcttattaaagacggtgggcatatttacgtatgtggtgat
gcaaaaatagcaaaagaaatgcaaaatcttataattgaagcaattatacaagggggtaaa
tcaaacgaactagctaaatctttaatgcataatcttagtaatactggacgttattctgtt
gatgtttggtaa

DBGET integrated database retrieval system