KEGG   Hydra vulgaris: 100208584Help
Entry
100208584         CDS       T01080                                 

Definition
(RefSeq) uncharacterized LOC100208584
Organism
hmg  Hydra vulgaris
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 435 aa AA seqDB search
MMVSLKMLIWFWKIFYIFCGSDFHSNKIISKITFGSCNKHDHDQPLWKKVREQTPDLWIW
LGDAVYADTRILPFLWVHSSLESMKEKFNLQKENPNYKLLSDDGIPIIGTWDDHDYGLDG
VGKAFKYRFQSQNLFLDFLDVPINSALRTRKGLYSSHTYGTGDQIVKVILLDVRSHHTKG
WDCEVLGEEQWVWLENQLNDNTSRVIFIGSGKQVLSDIPFIDKWMSCQSDLDRLIWLVQK
RSQVLFLSGDVHFSEVNCYNATSTGYPLYEVTSSGMTHSCSASLLPTGVCDWTLKNVVAS
RYRVSNVVTDKSFGMIQIDWSSSPVKFTFTLIGENGVISQMLLSSDDLIRRRHPTACPAA
LEQPNYYWKRVFWITVVLIGVSTLLTFLRVLFLLCRWIILRLLKDLDMKIKRRIKKIRLL
LPSSASWKRNKVHVE
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgatggtttctctaaaaatgttaatatggttttggaaaattttttatatattttgtggg
tcagattttcacagtaacaaaattatttctaaaattacttttggcagttgcaataaacac
gatcacgatcaaccattgtggaaaaaagtaagagaacaaactccagatttatggatatgg
ttaggagatgctgtttatgctgatacacgaatattaccttttttatgggttcattcatcc
ctggaatcaatgaaagaaaagtttaatttgcaaaaagaaaatcctaattataaattactg
tcagatgatggtattcctataatcggtacatgggatgatcatgattatggtttagatggt
gttggcaaggcatttaagtatcgtttccaatcacagaatttgttcctggattttctcgac
gtgcctataaacagtgctcttagaacaagaaaagggttgtactcatcacatacatatggg
actggtgatcaaatagtaaaggtaattttactggatgtaagaagtcatcacactaaaggt
tgggattgtgaagtgttaggggaagaacaatgggtctggcttgaaaaccagttaaatgac
aacacttcaagagttatttttatagggtcaggaaagcaggtactctctgatatacccttt
attgataaatggatgagttgtcaatcagatttggacagattaatttggttggttcaaaaa
cgatcacaggttttatttttaagcggtgatgttcacttttcagaagtaaactgttacaat
gcaactagtacaggctatccattatatgaggtgacatcaagtggaatgactcattcttgt
tctgcttctttattacctactggtgtgtgtgattggactttaaagaatgttgttgcgtct
cgttatcgagtttcaaatgttgttactgataaaagttttggaatgatacaaatagattgg
agctcgtcgcctgtgaagtttactttcacgttaattggggaaaatggggtaatctctcaa
atgctattatcttcggatgacctcatacggcgtcgtcatcctactgcctgtccagctgct
ctagaacagccaaattattattggaagcgtgtgttttggataacagtagtgttaattggg
gtttcaactcttttaactttcttaagggttctatttttgctttgtcgttggattattctt
cgtttattaaaagatctcgatatgaaaattaaaagacgaattaaaaaaattcgcttgcta
cttccgagctctgcatcctggaaaagaaacaaagttcacgtagaataa

DBGET integrated database retrieval system