KEGG   Hydra vulgaris: 100208604Help
Entry
100208604         CDS       T01080                                 

Definition
ubiquitin carboxyl-terminal hydrolase 5-like
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
hmg  Hydra vulgaris
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 803 aa AA seqDB search
MADNSANKIISSYSFTIPSSGDKIYKEECVYCFDSAISDGGLYVCLSTLWSTCRRHLHIH
VRKKEKTVFLHLKKIEVIKDNESCSPEKKPTKLAIGVEGGFDVNQDKTEYEDVNCLVLTD
LNGVEVKRWSLPDITLPINAQLSITAVLTLQGATVQDTIQAWQEKRNVSRHAMDLKQLNN
GVKVFPRGWKCAHCNLTTNLWLNLTDGTILCGRKYFDGSGGNNHAADYYKQTGYPLAVKL
GTITAEGGDVYSYEEDDMVEDPKLSQHLLHFGINIDQLKKTDKSMTELEIEANLSLKAEW
DAIQESGKKLVPLYGPGYTGMINLGNSCYMNSVMQVLFSFKEFQDAFALPSEQIFETSQA
IPPLDLNIQLAKLGAGLLSGIYSQPQYENQDQLGVRPQMLKSLIGQGHAEFSTNHQQDAH
EFFLHLLNKVEDNLLTPLHKLFSFQFEERLQCMQSNKVSYSRRTDMVLSLPVPLHAATNK
DEFKKFDEKYKEAKQKKLYTEPNSIVRLKVPMSACLEAFIADDIIEGYYSSAVKANTVAK
KKIRFATFPQYLVVQLKKFTAGDDWMPQKLDVMVDVPDELDLNHLRGNGLQPGEELLPSE
ELSAPGPTANEEYVSQLMNMGFSFEVCKKAVILSNNQGIEAAMNWIFEHSEDPDFESPIV
QPSFSQPSSLDPSAIDLIVSMGFGKELAILALQKNQNNIEAATNWIFSQQDEFFPTQDCD
PTLPIEKANESEKDISDTYGFSKESLKFLISYISGRKQRVRIGPSVSNWVDILSGAPQDT
ELCNFADDNTLYACDYSLENVIF
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggcggacaattctgcaaataaaataatatcatcatacagttttactattcccagttct
ggtgataaaatctataaagaagagtgtgtatattgctttgattctgcgatatcagatgga
ggtttatatgtttgtttatcaacactttggtctacttgtagaagacaccttcatatacat
gttcgaaagaaagaaaaaactgtatttcttcatttaaagaaaatagaggttatcaaagat
aatgaaagttgttctcctgaaaagaaaccaacaaagcttgcaataggtgtagagggtgga
tttgatgtaaaccaagacaagacagaatatgaagatgtcaactgtctggtgctaactgac
ttgaatggagtagaagttaagcgatggagtcttccagacataactttaccaatcaatgct
cagctttcaattacagcagtattgacattacaaggagctactgttcaagatacaatacaa
gcttggcaagagaaacgtaatgtttctaggcatgctatggatttaaaacaacttaacaat
ggtgtgaaggtttttccaagaggatggaagtgtgcccattgtaacttgacaactaatttg
tggctaaatttgacagatggaactattttatgtggaagaaaatattttgatggatcgggt
ggtaacaatcatgcagcagactattacaaacaaacaggctatccattagcagtcaaactt
ggaacaataacagcagaaggtggggatgtatattcatatgaagaggatgatatggtggaa
gatccaaaattatcccagcacctactccattttggaataaatattgaccagttaaaaaag
acagataaatcaatgacagagttagaaattgaagcaaacttgtctttaaaagcagaatgg
gatgcaatacaagaatctggaaaaaagctagtcccactatatggacctggctacactgga
atgattaatttagggaacagctgctatatgaattcggtgatgcaagtattgttttcattt
aaagaattccaagatgcatttgctttgccgtcagagcagatttttgaaacttctcaagct
atacctccattagatttaaatattcaacttgctaaacttggagcaggtttattgagtggt
atttattcacagccccagtacgaaaatcaggatcagttgggtgtgcgtcctcaaatgtta
aaatcattgataggacaaggacatgctgagttttcaacaaaccatcaacaagatgctcat
gaattttttttgcatttacttaataaagttgaagataatctgttgacaccattacataaa
ttatttagtttccaatttgaagaaagactacagtgcatgcagagtaacaaggtgtcttat
tcaagacgaactgatatggtcttaagtctacctgttcctcttcatgcagctacaaataaa
gatgagtttaaaaaatttgacgaaaaatacaaagaagcaaaacagaaaaaactctatact
gagcctaattctattgtcagactaaaagtgccgatgtctgcctgcttagaagcatttata
gctgatgatataattgaaggatattatagttctgctgtgaaagccaacactgttgctaaa
aaaaagataaggtttgcaacatttccacagtatctagttgtgcaacttaaaaagtttaca
gcaggcgatgattggatgccgcaaaaacttgatgtgatggttgatgtccctgacgagctt
gatctaaatcatcttagaggtaatggtttgcaacctggtgaagaattgcttccatcagaa
gagttatctgccccagggccaactgctaatgaagagtatgttagtcaattaatgaatatg
ggtttttcatttgaggtttgcaagaaagctgttatattatctaataatcaaggtattgaa
gcagccatgaattggatttttgagcattctgaagatcctgattttgaatcacctattgtt
cagccatctttctcacaaccctcctctctggatccttctgctattgatttaattgtttca
atgggttttggaaaagaacttgctatattggcattacaaaaaaatcaaaataacatcgaa
gctgcaacaaattggatattttctcaacaagatgagtttttcccaactcaagattgtgat
ccaactctaccgattgaaaaagctaatgaaagtgaaaaagatatcagtgatacgtatggt
ttctctaaagaaagtcttaaatttcttatatcgtatattagtggtcgtaaacaaagggta
aggataggaccatctgtttctaattgggttgatattttgtcgggagcgcctcaagatact
gaattgtgcaactttgcagatgataatacgctgtatgcctgtgattacagcttagaaaat
gttattttttga

DBGET integrated database retrieval system