KEGG   Hydra vulgaris: 100208670Help
Entry
100208670         CDS       T01080                                 

Definition
eukaryotic elongation factor 2 kinase-like
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     100208670
Protein kinases [BR:hmg01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   100208670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 621 aa AA seqDB search
MSQVDCDTNIQNDNDLNSQKKNNSEVSKILKARSRLISYDSIKESYPEDKSDQHNPIHIS
KSFPNSHGNWIDAIKKAKKVKDPWAEFNIAELYPTERVQRYRYQASKKKWIQDIIFVKME
TEPFAKGAMRKCFRMKKLPTTVHTNDWAYANNIVAKIHMNETIMAKQYFDDVKLQMDAKL
WAEEYNRRDPPKKIDIMQQACCKFIHREGQPMYHIENFIEGNYVKYNSNTGFVLHEEDTH
VRATPQAFSHFTFERSGHQLIIVDIQGVGDLYTDPQIHTANGDDYGDANLGTKGMALFFG
THQCTELCEKLNLKKFDLSEEEKKRIDNAGSKSSSSTELKSDTFSGSSRRISVNFEIIKS
ISSSSLQSNEEFSEPPSPRNVFDDGNDNYFEQHLHISSSAAPMEELTQELIKDRLNGLAN
FQEQQISTLGKVHFELATYNYIGRFTDTKPDFSSALFHLYQAASCGDLSANKILAYKYFN
FHTDEFEDLLIQEDHDLGMNFMIEAATRNDKDCMMKTAKAFDTGIMLGKKRSQCWKEALK
WYEAALNHHSAFSCLDSDPKHMIKARMAEIWRCGGYGVEKDPSYAGELYSSAAEDALQLG
KGKLANSYLMLAEESFGEVEE
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagttgactgtgatacaaatattcaaaatgacaatgatttaaacagtcaaaag
aaaaataatagtgaagtatcaaaaatattaaaggctagaagtcgtttaatttcatatgac
tcaattaaagaatcatatcccgaagataagtcagatcaacacaatccaattcacatctcg
aaatcttttccaaatagccatggaaactggatagatgcaattaaaaaagctaaaaaagtt
aaagatccttgggctgaattcaacattgctgaactatacccaactgaaagagtgcaaaga
tatcgttaccaagcttcaaaaaaaaaatggatccaagatattatatttgtaaagatggaa
acagagccatttgcaaagggtgctatgaggaaatgttttagaatgaagaaactcccaact
actgttcatactaatgactgggcatatgctaataatatagttgcaaaaatacatatgaat
gagacaattatggcaaagcagtactttgatgatgttaaactacaaatggatgctaaactt
tgggcagaagaatataacagaagagatcctccaaagaagatagacataatgcaacaggcc
tgttgcaagtttatacatcgagaaggccagccaatgtatcatattgagaatttcattgaa
ggaaattatgttaaatataactctaatacagggtttgtacttcatgaagaagatacacat
gttcgagcaacaccgcaggcttttagccattttacatttgaacggtctggtcatcaactt
attattgtagatattcaaggagtaggagatctgtacacagatcctcaaattcatactgca
aatggagatgattatggtgatgctaatttaggaacgaaaggaatggcactattttttggc
actcaccagtgcacagaattatgtgagaaattgaaccttaaaaagtttgatttatctgaa
gaggaaaagaaaagaatcgataacgctggttcaaaatcaagttcaagtactgaacttaaa
tctgatacatttagtgggagctctcgcagaatttcagtcaattttgaaattattaaaagt
ataagttcatcaagtttgcagtcaaatgaagaattttcagaacccccttcacctcgaaat
gtctttgatgacggcaatgataactattttgagcaacatttacacatatcttcttcagct
gctccaatggaagagctaactcaagagctgataaaagataggctgaatggtcttgctaac
tttcaagagcagcaaatttctacactcggaaaggttcactttgaactagcaacttataac
tacattgggcggtttactgacacaaaaccagatttctcatctgcactatttcatttatac
caagctgcatcatgtggtgatctttctgcaaataaaatccttgcatacaagtactttaat
tttcacacagatgagtttgaagatcttcttatccaggaagatcatgatctaggaatgaat
ttcatgattgaagctgctactcgtaatgataaagattgcatgatgaaaacagcaaaagca
tttgatacaggaattatgctggggaaaaaaaggagtcaatgctggaaagaagcattaaaa
tggtatgaagctgcattaaatcatcattctgctttttcgtgcttggattccgatccaaaa
cacatgattaaagcgcgtatggcggaaatatggaggtgtggtggctacggagtagaaaaa
gatccaagttacgccggagaactttacagctcagctgctgaagatgctcttcaattaggg
aagggaaaattagcgaattcgtatttgatgctggctgaagaatctttcggagaagtcgag
gaatag

DBGET integrated database retrieval system