KEGG   Hydra vulgaris: 100209337Help
Entry
100209337         CDS       T01080                                 

Definition
delta-aminolevulinic acid dehydratase-like
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hmg  Hydra vulgaris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hmg00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 139 aa AA seqDB search
VTIMSYSAKFASCFYGPFRDAAASAPAFGDRRCYQLPPQSSGLANRSVSRDVSEGADILM
VKPGMAYLDVVKEIKNKYPDYPVAVYQVSGEYAMLYHASQQGAFDIKQAVIESLHCMMRA
GATVLISYFTPQVLKWLKE
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
gttaccataatgagctattcagctaaatttgcatcctgtttttatggtccattcagagat
gcagctgcttctgctcctgcatttggtgatcgcaggtgctatcaacttccgccacagtct
tctgggctagctaatagatcagtgtctcgtgatgttagtgaaggcgctgatattctaatg
gtcaagccaggaatggcttatcttgatgttgtaaaagagattaagaacaagtatccagat
tatcctgttgctgtttatcaggtatccggtgaatacgccatgctttatcatgccagtcaa
caaggtgcttttgacatcaaacaggctgtcatagagtcattacattgcatgatgagggcc
ggcgctactgttttaatttcatattttactccacaagttttgaaatggttaaaagaataa

DBGET integrated database retrieval system