KEGG   Hydra vulgaris: 100209337Help
Entry
100209337         CDS       T01080                                 

Definition
delta-aminolevulinic acid dehydratase-like
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hmg  Hydra vulgaris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100209337
Enzymes [BR:hmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     100209337
Exosome [BR:hmg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100209337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 139 aa AA seqDB search
VTIMSYSAKFASCFYGPFRDAAASAPAFGDRRCYQLPPQSSGLANRSVSRDVSEGADILM
VKPGMAYLDVVKEIKNKYPDYPVAVYQVSGEYAMLYHASQQGAFDIKQAVIESLHCMMRA
GATVLISYFTPQVLKWLKE
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
gttaccataatgagctattcagctaaatttgcatcctgtttttatggtccattcagagat
gcagctgcttctgctcctgcatttggtgatcgcaggtgctatcaacttccgccacagtct
tctgggctagctaatagatcagtgtctcgtgatgttagtgaaggcgctgatattctaatg
gtcaagccaggaatggcttatcttgatgttgtaaaagagattaagaacaagtatccagat
tatcctgttgctgtttatcaggtatccggtgaatacgccatgctttatcatgccagtcaa
caaggtgcttttgacatcaaacaggctgtcatagagtcattacattgcatgatgagggcc
ggcgctactgttttaatttcatattttactccacaagttttgaaatggttaaaagaataa

DBGET integrated database retrieval system