KEGG   Hydra vulgaris: 100209441Help
Entry
100209441         CDS       T01080                                 

Definition
cytochrome c-like
Orthology
K08738  
cytochrome c
Organism
hmg  Hydra vulgaris
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100209441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 112 aa AA seqDB search
MGAEKIPTGDATKGAKVFKQRCAQCHVIDQSGKHKTGPNLYGLIGRKTGQAPGFSYTQAN
QNKGITWNKDTLWVYLENPSKYIPGTKMVFAGIKKGQERADLIAYLEEECKK
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgggagctgaaaaaattccaactggagatgccacaaaaggtgcaaaagtatttaaacaa
agatgtgctcaatgtcatgtaattgaccaaagtggaaagcataaaactggacctaatctt
tatggattaataggtcgaaaaactggacaagctccaggttttagttacacacaagcgaat
caaaataaaggaattacctggaataaagatacactgtgggtctacttagaaaatccttct
aagtatatacccggaactaaaatggtgtttgcaggaattaaaaaagggcaagagagagct
gatttaattgcctacttggaagaagagtgtaaaaaatag

DBGET integrated database retrieval system