KEGG   Hydra vulgaris: 100209441Help
Entry
100209441         CDS       T01080                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
hmg  Hydra vulgaris
Pathway
hmg01100  Metabolic pathways
hmg04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100209441
 Cellular Processes
  Cell growth and death
   04215 Apoptosis - multiple species
    100209441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128 CCP_MauG Cytochrome-c551
Motif
Other DBs
NCBI-GeneID: 100209441
NCBI-ProteinID: XP_004209990
UniProt: T2MEP5
Position
Un
AA seq 112 aa AA seqDB search
MGAEKIPTGDATKGAKVFKQRCAQCHVIDQSGKHKTGPNLYGLIGRKTGQAPGFSYTQAN
QNKGITWNKDTLWVYLENPSKYIPGTKMVFAGIKKGQERADLIAYLEEECKK
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgggagctgaaaaaattccaactggagatgccacaaaaggtgcaaaagtatttaaacaa
agatgtgctcaatgtcatgtaattgaccaaagtggaaagcataaaactggacctaatctt
tatggattaataggtcgaaaaactggacaagctccaggttttagttacacacaagcgaat
caaaataaaggaattacctggaataaagatacactgtgggtctacttagaaaatccttct
aagtatatacccggaactaaaatggtgtttgcaggaattaaaaaagggcaagagagagct
gatttaattgcctacttggaagaagagtgtaaaaaatag

DBGET integrated database retrieval system