KEGG   Hydra vulgaris: 100209489Help
Entry
100209489         CDS       T01080                                 

Definition
ubiquitin carboxyl-terminal hydrolase 12A-like
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100209489
Peptidases [BR:hmg01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100209489
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 396 aa AA seqDB search
MRERVPKGLSEGKRKLQMLTLKSIGANASSLEKDIGSEFPINEHFFGLVNFGNTCYCNSV
LQALYFCQPFREKVLSYKPLNKRKENLLTCLSDLFNSIATQKRKTGVIAPKRFVARLRKE
NELFDNYMQQDAHEFLNYLLNTIADLLQGEKLKEKEKEKLGSLSSVSSKASGSSGYSTTT
SQFTLKEPPEPTWVHDLFEGTLTNETRCLCCETLSSKDESFLDISVDVEQNTSISYCLKN
FSFTETLCSEQKYFCEVCGSKQEAQKRMMVKKLPQILALHLKRFKYVEQQQRFTKLSHRV
TFPLQLRLFNTLENATHRDRLYDLSAIVVHCGTGPNRGHYIAIVKSHNIWLLFDDDIVDK
IETRSIEDFFGLTTDVQKNSECGYILFYESHKLSLK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaagagttccaaagggtttaagtgaggggaaaagaaaattgcagatgctaact
ttgaaatcaattggagcaaatgcatcctctttagaaaaagacattgggtcagaatttcct
attaatgagcatttttttggactagttaattttggaaacacttgttattgcaactctgta
ctgcaagcattgtatttttgtcaaccatttcgtgagaaagttctctcttacaagcccttg
aataagcgtaaagagaaccttttaacatgtttgtcagacctttttaatagcatagctaca
caaaagagaaaaacaggagttattgctccaaaacgatttgtagcacgtcttaggaaggaa
aatgaactgtttgacaactacatgcagcaagatgcccatgagtttcttaattatctacta
aacactattgctgatcttttgcaaggtgaaaagctaaaggagaaagaaaaagaaaaactt
ggaagcttaagcagtgttagtagcaaagcaagtggtagttcagggtattccacaaccaca
agtcagtttactttaaaagagcctcctgaacctacctgggtgcatgatttatttgaaggt
acacttacaaacgaaacacggtgtctttgttgtgagacattaagtagcaaagatgaatca
tttttggatatatcagtagatgttgagcagaatacatcaattagttattgtttgaaaaat
ttttctttcactgaaactctgtgtagtgagcaaaaatatttttgtgaagtgtgtggtagt
aaacaagaagctcaaaaaagaatgatggtgaagaaattacctcagatacttgcattgcat
ttaaaaagatttaaatacgttgaacaacagcagaggtttaccaaactatcgcatagagtt
acatttccgcttcaacttcgattatttaatactttagaaaatgcaactcatcgcgaccgt
ttgtatgatctttcagcgattgtagttcactgtggcactggtccaaatcgtggtcattac
attgcaatagttaaaagtcataacatttggctgctttttgatgacgacattgtagataaa
atcgaaactcgttcaatcgaagatttcttcggattaactactgacgtacaaaaaaactcg
gaatgtggttacatattgttttacgaatcgcataagttatcgttaaagtag

DBGET integrated database retrieval system