KEGG   Hydra vulgaris: 100209516Help
Entry
100209516         CDS       T01080                                 

Definition
(RefSeq) centrosomal protein of 152 kDa-like
  KO
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.4.19.12]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100209516
Peptidases [BR:hmg01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100209516
Ubiquitin system [BR:hmg04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100209516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 477 aa AA seqDB search
MYSHIDFNTQEGDEEQLDLEGAHQQELKAFLPNELDDDYFCEDNSFTSHVFFEDALLTNQ
TSDENKKNNSSLMLNTDFPKETNIKENTFRFGSSKDRLKLGKNVNSLLQQKSCISELNNK
AESYVDVNRIKTEYLPKNSREHSEILYQATGRKIEELEKSLEERVEEKEKNIRVLRHKLT
MSSTKMEGLRIINGQLNAVIQDQKCEINNLQDLLQNEQKQCRLLTNQIKEANEKLFVSDS
TISELQMQIRELNQTESLSRAHHETILAYMREKYKEEVLSLKEKVGDLQQSLAWKGREIG
MLRNCLSNKEKKVTSLEKDLALLTKHSTALEEQLKMFKVALKTDSTFGNISSMPRNVATA
HMGRDQVEYKSPIARDINRLNIKSNDDSNVQNKSSKVKWLKEHNTDKDILIQNSVLSSKV
EFLNDFENQLAIETNQAVGVTRNERLMNHIETDSSIKQLNDEWNSEQQQYRDYHQFV
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtatagccacatagattttaacactcaggaaggtgatgaggagcaattagatctagaa
ggtgcacaccaacaagaattaaaagcatttcttcctaatgaattagacgatgattatttc
tgtgaggacaactcatttacatcgcatgttttttttgaggatgccttgcttactaatcaa
acttcagatgaaaataaaaagaataattcttcattaatgttgaatacagattttccaaaa
gaaactaacattaaagaaaatacattccgttttggatcgagtaaagaccgtttaaaatta
gggaaaaatgttaactcacttctgcagcaaaaatcttgtatatctgaattaaataataag
gctgagagctatgttgatgttaacagaataaagacagagtacttacctaaaaatagtaga
gaacattcagagattctttatcaagcaacgggaagaaaaatagaagagttggaaaaaagt
ttagaagaaagagtagaagagaaagaaaaaaatattagagttctcagacataagttaacg
atgagttcaaccaaaatggaaggtttaagaataattaatggtcaactaaatgcagtcatt
caagatcaaaagtgtgaaattaataatctgcaggaccttcttcaaaatgaacaaaaacaa
tgcaggctactaacaaatcagatcaaagaagcaaatgagaagctttttgtttcagattct
acaattagtgaattacagatgcaaatacgagaactcaaccagacagaatcattatcaaga
gctcatcatgaaaccattttagcttatatgagggagaaatacaaggaagaggttttatca
ttaaaagaaaaagtaggtgatctgcaacaaagtttagcatggaagggtagggaaatcggc
atgctgagaaattgcctttctaataaagaaaaaaaagtgacaagtctagaaaaagatttg
gctttactcacaaaacatagtactgctttggaagaacaactaaaaatgtttaaagttgct
ttaaaaacagattctacttttggtaatatatcttccatgcctcgtaatgttgcaactgcg
catatgggaagagaccaagttgaatataaatctccaattgcaagagatataaatagatta
aatatcaagtcaaatgatgacagtaatgttcaaaacaaatcatcaaaagtaaaatggctt
aaagagcacaacacagacaaagatattcttattcaaaattcagttttgtcatcaaaggtt
gaatttttaaatgatttcgaaaatcagttagctattgaaactaatcaagcagttggtgta
acaagaaatgaacggctgatgaatcatatagaaactgattcatcaatcaaacaattaaat
gatgaatggaactctgaacaacagcagtatagagattaccatcagtttgtgtga

DBGET integrated database retrieval system