KEGG   Hydra vulgaris: 100209516Help
Entry
100209516         CDS       T01080                                 

Definition
uncharacterized LOC100209516
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100209516
Peptidases [BR:hmg01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100209516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1266 aa AA seqDB search
MSSHHRCIFSANAEQLKITSATITPFLLDKGGICKLLQEKNNQSMFVYSIEDYTNEKKCR
KCNFKVEHDFKPIVKHRDCQFTIVLNGESKTQVIGKFCNVSDCVKLVEIFENIKNISNLN
NILLSSKENISSVYSSPNSVYCSTSMLSSTKNRTPLTPLGMSKVAPSNTSIRDHTPSKSI
CKQRLFPSFSNERDNDDFVSATAIGGKKASSKKLFRFRNKQSLSNHISESKTALIGFSNL
GNTCYMNSILQCLLNIPNFFQDMNDPGNINIVPTKSLYHSLYNLGVLKYSLDTLENQIFA
LKQVKSVISEAAVRFSGYAQHDAHEFLCQCLDQLKEDLLNNKDDSHLIDHNSSSDSDESS
REKCPIKQNFESKIMHTVVCKNCDEKVFKTEVCHDFSLVIPDFDENSDPSEQNLNQLIQM
YFSDEVVEYSCEKCKSSTSVLSHQFKKLPRVLIFHIKRYDISESKRCDRVVLPKLIDMKF
LATSNTALPKEYIFDKTKLWIKKPLLKNSSTEKRKTCETLDCEPLNKTSKMSLFPENDLK
KESFMSSSKTKENTNDTFTKLRNIDSKNDNGVFSPYSKYNTNSNNGSIGTYTDLDKKFEE
FTTVSDDEEEDLKKALELSMKDFNNKQHDDDLRYESLFKCDYVSDINPLSPSMKGLNEET
VSLKYSYNLVGVVNHHGAHTSTGHYTSDIYDFKSDCWKNYNDSTVKDIKVHEPWLSMPPK
SYNFAGVGLEGDEEQLDLEGAHQQELKAFLPNELDDDYFCEDNSFTSHVFFEDALLTNQT
SDENKKNNSSLMLNTDFPKETNIKENTFRFGSSKDRLKLGKNVNSLLQQKSCISELNNKA
ESYVDVNRIKTEYLPKNSREHSEILYQATGRKIEELEKSLEERVEEKEKNIRVLRHKLTM
SSTKMEGLRIINGQLNAVIQDQKCEINNLQDLLQNEQKQCRLLTNQIKEANEKLFVSDST
ISELQMQIRELNQTESLSRAHHETILAYMREKYKEEVLSLKEKVGDLQQSLAWKGREIGM
LRNCLSNKEKKVTSLEKDLALLTKHSTALEEQLKMFKVALKTDSTFGNISSMPRNVATAH
MGRDQVEYKSPIARLTLQTNLPVADAFSEAFLKIIKIYLRIPNCMNKNIKRNIKKSRMSR
ISSQIAEIPENIKAWSQNLVHFEKSKSAKKSVYLRCKRVNTELSDLWSIIKKVEILTNKY
QSVQKSKQCLEEKWDYLFDITKVNVYPSKAGRKRPSIPETDTVEVSDSNEEGDEQDFNYI
PPDKKS
NT seq 3801 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctcatcatcgttgtatattcagtgctaatgcggaacaacttaaaataacatct
gctacaattaccccattcttacttgataaagggggaatttgtaaacttttacaggaaaaa
aataatcaatcaatgtttgtttactctattgaagattatacaaatgaaaagaaatgtaga
aaatgcaattttaaagtagaacacgactttaaacctattgtaaagcatagagactgtcaa
ttcactattgtattaaatggcgaatctaagacccaggtcattggaaagttttgtaatgta
agtgactgtgtgaagttagtagaaatttttgaaaatataaaaaacatttcaaatttgaat
aacatattactaagttctaaagagaatatttcttcagtttatagtagtcctaattctgtt
tactgttcaacaagtatgctctcaagcactaaaaatcgaactccgttgacaccattggga
atgtcaaaagtagcaccatccaatactagtattcgcgatcatacaccttcgaaatccata
tgcaaacaaagactttttccatctttttcaaatgaaagagataatgatgattttgttagt
gcaacagcaattggtggaaaaaaagcttcatctaaaaaactttttcgttttcgaaataaa
caatctttatccaatcacattagtgaatcaaaaacagctttaatcggtttttctaatctt
ggtaatacatgttatatgaattcaattttacaatgtttactcaatataccaaattttttt
caagacatgaatgatccaggcaacattaacattgttccaactaaaagtttgtatcactct
ttatataatcttggtgtattaaagtactcattagatacacttgaaaaccaaatttttgca
ttaaaacaagtaaaatctgtaatttctgaagctgcagttagattttcaggttatgcgcaa
cacgatgctcatgaatttttgtgtcagtgtttggaccaattaaaagaggatttactaaac
aataaggatgatagccatttaatagatcataatagctcatctgattcagatgaaagctct
agagagaaatgtcctattaagcaaaattttgaaagcaagataatgcatactgtagtttgt
aaaaattgtgatgaaaaagtgtttaaaactgaagtgtgtcatgatttttctttagttatt
cctgattttgatgaaaactctgatccttcagagcaaaatttaaatcaattaatacagatg
tatttttctgacgaagttgttgaatacagttgtgaaaaatgcaagtcttcaacttctgtt
ttgtctcatcaatttaaaaagttgccacgtgtactcatatttcatataaaacgatatgat
atttctgaaagtaaaagatgtgatcgtgttgtccttccaaaattgattgatatgaagttt
cttgcaacaagcaatacagcactaccaaaagagtacatttttgacaaaaccaagctttgg
ataaagaagccattgcttaaaaactcaagcactgaaaaacgaaaaacttgtgaaacctta
gattgtgagccgctgaataaaacttctaaaatgtcattgtttcctgaaaatgatttaaaa
aaggaatcttttatgagttcaagcaaaacaaaagaaaatactaacgacacatttacaaag
ttaagaaatattgattccaaaaatgataacggtgttttctctccttattctaaatacaac
acaaatagtaacaatgggtctattggaacttatactgatcttgataagaaatttgaagaa
tttacaacagtgtcagacgacgaagaagaagatttaaaaaaagcccttgagttgagcatg
aaagattttaacaataaacaacatgatgatgacttaagatatgaaagtttatttaaatgt
gactatgtctccgatataaatccattatcaccaagcatgaaaggtcttaatgaagaaact
gtttctctaaaatattcttataatttagttggtgtggttaatcaccacggagctcacaca
agtactggacactacacaagtgatatttatgattttaagtctgactgctggaaaaattat
aatgactctacagttaaagatattaaagttcatgaaccctggctatcaatgcctcctaaa
tcttataattttgctggggttgggttggaaggtgatgaggagcaattagatctagaaggt
gcacaccaacaagaattaaaagcatttcttcctaatgaattagacgatgattatttctgt
gaggacaactcatttacatcgcatgttttttttgaggatgccttgcttactaatcaaact
tcagatgaaaataaaaagaataattcttcattaatgttgaatacagattttccaaaagaa
actaacattaaagaaaatacattccgttttggatcgagtaaagaccgtttaaaattaggg
aaaaatgttaactcacttctgcagcaaaaatcttgtatatctgaattaaataataaggct
gagagctatgttgatgttaacagaataaagacagagtacttacctaaaaatagtagagaa
cattcagagattctttatcaagcaacgggaagaaaaatagaagagttggaaaaaagttta
gaagaaagagtagaagagaaagaaaaaaatattagagttctcagacataagttaacgatg
agttcaaccaaaatggaaggtttaagaataattaatggtcaactaaatgcagtcattcaa
gatcaaaagtgtgaaattaataatctgcaggaccttcttcaaaatgaacaaaaacaatgc
aggctactaacaaatcagatcaaagaagcaaatgagaagctttttgtttcagattctaca
attagtgaattacagatgcaaatacgagaactcaaccagacagaatcattatcaagagct
catcatgaaaccattttagcttatatgagggagaaatacaaggaagaggttttatcatta
aaagaaaaagtaggtgatctgcaacaaagtttagcatggaagggtagggaaatcggcatg
ctgagaaattgcctttctaataaagaaaaaaaagtgacaagtctagaaaaagatttggct
ttactcacaaaacatagtactgctttggaagaacaactaaaaatgtttaaagttgcttta
aaaacagattctacttttggtaatatatcttccatgcctcgtaatgttgcaactgcgcat
atgggaagagaccaagttgaatataaatctccaattgcaagattaacactacaaaccaat
ttacctgttgctgatgctttttctgaagcatttttaaaaataatcaaaatctatttaaga
atacctaattgcatgaacaaaaatataaagagaaatattaaaaagtcaagaatgtcaaga
ataagctcgcagatagctgaaatacctgaaaatatcaaagcctggtctcaaaatctagtc
cactttgagaaatcaaaatcagcaaagaagtcagtttatttgagatgtaaaagagttaac
acagaattatctgatttatggtctataataaaaaaagtggaaattctcactaacaagtat
caatcagttcaaaaatctaaacaatgtcttgaagaaaagtgggattatttatttgatata
actaaagtaaatgtatatccatctaaggctggcaggaaaagacctagtatacctgaaaca
gatacagtagaggtcagtgacagcaatgaagaaggggatgaacaagattttaattatatt
cctccagacaaaaaaagttaa

DBGET integrated database retrieval system