KEGG   Hydra vulgaris: 100209537Help
Entry
100209537         CDS       T01080                                 

Definition
(RefSeq) mitogen-activated protein kinase 1-like
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
hmg  Hydra vulgaris
Pathway
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    100209537
   04068 FoxO signaling pathway
    100209537
   04150 mTOR signaling pathway
    100209537
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    100209537
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100209537
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100209537
Protein kinases [BR:hmg01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100209537
Chromosome [BR:hmg03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100209537
Exosome [BR:hmg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100209537
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 354 aa AA seqDB search
MASAEIVRGQVFDVGPRYKDLSYIGEGAYGMVCCATDIYTGNKVAIKKISPFEHQTYCQR
TLREIKILSRFNHENIINIQDIKRSPTIDDMKDVYIVQTLMETDLYKLLKTQKLSNDHIC
YFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPEHDHTGMLTEY
VATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPLFPGKHYLDQLNLILNVLGSP
DKESLEFIRNLKAKSYLQGLPIKERTPWKTLFPEADPKALDLLDKLLAFNPNKRVTVEEA
LAHEYLEQYYDPNDEPVAEEPFTFDTELDDLPKEKLKEMIFESTHMYGSAAHPF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgcagaaattgtacgtggccaagtttttgatgtcggtccacgttataaggat
ttaagttacattggagaaggagcttatggaatggtttgctgtgctacagatatatacact
ggtaataaagttgcaataaagaagattagcccttttgaacatcagacttattgtcagcga
actcttagagagataaagattttatcacggtttaatcatgaaaatatcataaacatacaa
gatataaaacgctcacctacaattgatgatatgaaagatgtatatattgtacagacctta
atggaaactgatttatacaaacttttaaagacgcaaaaactaagcaatgatcacatatgt
tactttttatatcaaatattaagaggtttgaaatatatacattcagcaaatgttttgcat
cgagatttaaaaccaagcaacttactgcttaataccacatgtgatcttaagatttgtgat
tttggattagctcgtgttgcagatcctgaacatgaccacactggcatgcttactgaatat
gttgcaacaagatggtatagagcacctgaaattatgttaaattccaaaggttatacaaaa
tccatagacatatggagtgttgggtgcattcttgctgagatgttatccaataggccacta
tttcctggaaaacattatttggatcaattgaaccttattttaaatgttcttggctctcct
gataaagaatcattggaatttataagaaatttaaaggctaaaagttatttgcaaggttta
ccaattaaagagagaacaccatggaagactttgtttcctgaagcagaccctaaagctttg
gatttacttgataagctcttagcttttaatccaaataaacgtgtgactgtggaggaagca
ctggcacatgaatacttagaacagtattatgatccaaatgatgagcctgtagcagaagag
ccatttacttttgacactgagttggatgatctacctaaggagaaattaaaagaaatgata
tttgaatcaactcacatgtatggttctgctgctcatccgttctag

DBGET integrated database retrieval system