KEGG   Hydra vulgaris: 100209922Help
Entry
100209922         CDS       T01080                                 

Definition
OTU domain-containing protein 5-like
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100209922
Peptidases [BR:hmg01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   100209922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 452 aa AA seqDB search
MTILPKKKEQKNDEVERNRSRNRTTRSGEVVRNRNNQDENISESSNSLDKRDSQELLNLP
LHKRSRHRQSSNYFSKNSRETREGSVSPPYDVNENGYNSSDEYDSLREIKKGVIKLDGPT
AEQESEFEKQLLLKRGFQIKQMGTDGACLFRAVADQVYGDQEMHSVVRKHCIDYMVKNSD
FFSQYVTEDFHTYVRRKRNDSIHGNHVEMQALSEIYNRPIEVYQYGCEPINIFHSRSSNS
DENPPLRLSYHGSIHYNSVIDPYNPTVGVGLGLAGYKPGMHDQRLLQSTIQESEAQLLEQ
EMLQDKLKATDWEATDEHLTEVAARESYLEWVRENQSKEKNNGASSSTCTSSQIRNSPGH
RSPSNESNSRCSPRGEKHINLSMLSKDNEANAKNNTCISLSTPNVDDWSYALGYSEDWDT
DPVLAAVLAQSQQEYLQEISRLNSTVNKECDK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgactatattacccaaaaaaaaagagcaaaaaaatgatgaggtagaaagaaatcgttca
agaaacagaaccactcgtagtggtgaagttgttagaaatagaaataatcaagatgaaaac
atttcggaaagttcgaatagtttagataaaagagactctcaagaattattaaatttgcca
cttcataagcgttcgagacaccgtcaaagttctaactatttttcaaaaaacagcagagaa
actcgcgaaggtagtgtcagtccgccatatgacgttaatgaaaatggatataatagttct
gatgaatatgatagtcttcgagaaattaaaaagggtgttataaaacttgatggtccaact
gcagagcaagaatctgagtttgaaaagcagttacttctaaaaaggggttttcaaattaaa
caaatgggtacagacggagcttgtttgtttagagctgtagctgatcaagtttatggagat
caagagatgcacagtgttgtaagaaaacattgcattgattatatggttaaaaacagtgat
tttttctctcaatatgttactgaagattttcatacttatgttagaagaaaaagaaatgat
tcaattcatggaaatcatgtggaaatgcaagcgcttagtgaaatttataatcgacccatc
gaggtttaccaatatggatgtgaaccaataaatatttttcacagtcgatcttctaatagc
gatgaaaatccaccactacgactcagttatcacggaagcatacattataattctgtcatt
gatccatataatccaacagtaggagtaggtcttggactagcaggatacaaaccagggatg
catgaccaaagattgttacaaagtacaatacaagaatccgaagctcagcttttagaacaa
gaaatgttacaagataagttaaaagcaactgactgggaagcaactgatgaacacctaact
gaagttgctgctagagaatcttacttagaatgggtcagagaaaatcaaagtaaagaaaaa
aataacggtgcctcgagttctacttgtacttcatctcaaattcggaattcgccaggacat
cgttcaccaagtaacgagagcaactctcgatgttcgcctcgtggcgaaaagcatataaat
ttatctatgttatcaaaagataatgaagcaaatgctaaaaataatacttgtatttcgcta
tcaactccaaacgtagatgattggagctatgctttaggttatagcgaagattgggacact
gacccggtattggctgcagtacttgcgcaatcacaacaggagtatttgcaggaaatatcg
aggttaaattctactgtaaataaagaatgtgacaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system