KEGG   Hydra vulgaris: 100210252Help
Entry
100210252         CDS       T01080                                 

Definition
ubiquitin carboxyl-terminal hydrolase 10-A-like
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100210252
Peptidases [BR:hmg01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100210252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 382 aa AA seqDB search
SISNLKIDFSCHHLQLRGLINRGNWCYINTTLQALLAISPISHFYKSLKTFLNTDVSYTS
TPLTDSMIAFFNEFESINPKISLKKQSEDIKTGASFEPRCIYNVLTTMKASLSEKGRQED
AEEFLSYLLNGIHDELVALNKLLSKKTPNGNDNADLDNENDDSSWSQVGTKKKDLAKKVN
PSSDSTIIKQIFGGMIRSSVQQSGVKESTTLQPFFTLQLDIQGDEIWCLEKAIESYFVKE
ILQGFTCSKTNTEVEASRKLSIEELPLVLIFHLKYFVYDRTGGSQKIYKAIDIPVDLEIP
KDVLSPSLKVSLNERQYRLYAVIHHHGKHAAGGHYTASVHHGSPFGWVNFDDNIIKTLNV
NQVLRKQQGSVPYLLFYERCQR
NT seq 1151 nt NT seq  +upstreamnt  +downstreamnt
aatccatatccaatttaaagatagatttttcatgtcatcacctgcaacttcgtggtttga
tcaatagaggtaattggtgttacatcaatacaacattacaagctcttcttgcaatttctc
caatatctcatttttataagtctctcaagacatttctaaatacagatgtaagctacacct
caacccctttaactgacagtatgattgctttttttaatgaatttgaatccataaatccga
aaatttcattaaaaaaacaaagtgaagatataaaaactggtgcttcgtttgaaccacgat
gtatatacaatgttttaactacaatgaaggcatctttatcagaaaagggtcgtcaggaag
atgctgaagaatttttatcatatttattaaatggcattcatgatgagctagttgcattaa
acaaactgctatcaaaaaaaacacccaatggaaatgataatgcagatttggataatgaaa
atgatgatagttcttggtctcaagttggtaccaaaaaaaaagatcttgctaaaaaggtta
atccatcatcagatagtacaataataaagcagatttttggtggcatgattcgatcatcag
ttcagcaaagcggagtaaaggagtcaactactttgcaacctttcttcacattacaactag
atattcaaggggatgaaatctggtgtttagaaaaagcaatagaatcgtattttgttaaag
agattcttcaagggttcacttgttctaaaacaaatactgaggtagaagcatcgcgcaagt
tatcaattgaagaacttcctttagtccttatattccatttaaaatattttgtctacgaca
gaactggtggaagtcaaaaaatttataaagctattgatatacctgttgatcttgaaatac
ctaaagatgtgttatcaccgtcattgaaagtttctttaaatgaaagacaatacaggctat
atgcagttattcatcatcatggtaaacatgcagcaggtggccattatactgcttcagtgc
atcatggcagtccatttggttgggtaaactttgatgataatataataaaaacacttaatg
ttaaccaagttttgcgcaaacagcaaggtagtgttccctacttgctattttatgagagat
gtcaaaggtaa

DBGET integrated database retrieval system