KEGG   Hydra vulgaris: 100210375Help
Entry
100210375         CDS       T01080                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform-like
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
hmg  Hydra vulgaris
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100210375
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100210375
   04070 Phosphatidylinositol signaling system
    100210375
   04150 mTOR signaling pathway
    100210375
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100210375
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100210375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1051 aa AA seqDB search
MVTGALARYNIWNGLTINSKIDVLCMLPSGICITLQKVQIDIPLSEIKNKLWQDAAHFSN
KTALLSKENYVFVAVSAKGGTEELMDEELSLFDIKPVRPYLKIVQKQGDESVKLISSKIN
LLIGNNTISSKNEEVDEFRSKCIQFCDFISYQRSQSSWDRKAIYTYPPEFEEDYNLSSSL
KEKLRIENNCIHLSVSIVKNSFITFKVADNIYPKELIEKVLCKKIQTSKLAQKENVNDYV
LKVYGRLNFFLGHVVTDSFGNEILEEKPILQYKYVRDCLQWDKPIRLVLIPKADLDIEKE
CAAPILDNPPPTPEKRKKNEICLWDISPKTLFKVNIFAAKGIHNAQMWKEIHCGIFHGGE
EVCKVQSTNKLQQSTTPHWNEFLEFDLPVADIPRMARLCFSIVGYQQNDRKKRKPVCIGW
VNMPIFNYKAYLKTGTCALYCWQYSIGRKNENQNFLNPLGTVASSGDENGACLIIKLTEF
AHPVVYPSEEKIIQYAADKIKAEQVNGDQPHPYLRKGGKLHRQQIEEVIQRDTLLPMFEK
EKELMWLLRVECSLEYPQCLPKLLQCVKWNNRDSVAQIHLLLTTWKIDPLEVDVALDLLD
YKFPDNNVRTIAVKVLDNLTDGELEMYLLQLIQALKYESYLDSPLAKYLLKRALNNRRIG
HYLFWHLKAEAGNLECSLQFGLLLELYCRGSVQHIDILTKQVEAINKMKTMTEYLHQCKD
QSKEDKIEMMRNIFNGSSYKKAFSEIVSPLDPSIKLKCLRVEKCKYMDSKKKPLWLVFEN
VDEGADDVVIIFKNGDDLRQDMLTVLSLRIMDNVWKKAGLDYGIIPYRCLSTGPMLGLIE
VVPESETLGKIQFARGAFGTWKDDTFFLWLKDQCQGSDEKLEKFIQNFTRSVVGYSIATY
VLGVGDRHNDNIMMKKDTGQLFHIDFGHFLGNFKTKFGFKRERVKFVLTSDIVYVISKHM
NIDDFKDMCIVAFKTLRSRGNLFITIFAMLLSTGIPELEHPNDIEYIRESMALTKDEADA
VKHFEMSYKEAYNNRASTTLNWSLHNVVHNW
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atggtgactggtgctttagctcgctataacatctggaatggcttaacaatcaatagtaaa
atagatgtgctgtgtatgctgcctagtggtatctgtataactcttcaaaaggttcagatt
gatatacctttatcagaaatcaaaaataaactttggcaagatgctgctcacttttctaat
aagactgctttgctttcaaaagaaaattatgtttttgttgcagtaagtgctaaaggtggt
accgaggagttaatggatgaagagttatccctctttgacattaaacctgttagaccttat
ctgaagattgtgcaaaagcaaggcgatgaatcagtaaaattgattagttcaaaaataaat
ttattgattggaaacaacacaatttcttccaagaatgaagaagttgatgaatttcgaagc
aaatgtatccagttttgtgattttatttcttatcaacgcagtcaatctagttgggatcga
aaggcaatttacacttacccaccggaatttgaagaagactataatctttcatcatcatta
aaagaaaaactaagaattgaaaataattgtattcatttatctgtatccattgttaaaaat
agttttataacatttaaagttgctgataatatttatccaaaagagctcatagaaaaagtt
ctttgtaagaagattcaaacatcaaagctagcacagaaagagaatgtaaatgattatgtt
ttgaaagtttatggtcgcttaaattttttccttggtcatgttgttacagattcatttgga
aatgagattcttgaagagaaacctattttacaatataagtatgttagagattgtttgcag
tgggacaaacctatcaggttggttcttatacctaaagcagatcttgatattgaaaaagaa
tgtgcagctcctatattagataatccaccaccaactccagaaaaacgaaaaaaaaatgaa
atttgtttatgggatattagtccaaaaacattatttaaagttaacatatttgcagccaaa
ggaattcataatgcacaaatgtggaaagaaatacattgtggtatatttcatggtggggaa
gaagtttgtaaggtacaatcaactaataaattgcaacaatctacaactccacactggaat
gaatttcttgaatttgatctccctgttgctgacattccaagaatggcacggttatgtttt
agtattgttggctatcaacagaatgatcgcaaaaagcgcaagcctgtatgcattggttgg
gtcaacatgcctatttttaattataaagcatatttaaaaactggcacttgtgctctatac
tgttggcaatattcaattggacgaaagaatgaaaatcaaaattttttaaatcctcttgga
acagtagcttcaagtggtgatgaaaacggagcttgtcttattattaagttaactgagttt
gctcaccctgttgtttacccctcagaggaaaagataattcaatatgctgcagataaaata
aaagctgaacaagtaaatggcgatcaaccgcatccttatttgagaaaaggaggtaagctg
catagacaacaaattgaagaggtcatacaaagagataccttattaccaatgtttgaaaaa
gaaaaagaactaatgtggttactaagagtagaatgttctcttgaatatcctcaatgtctt
ccaaaactattgcagtgtgtcaaatggaacaatcgagatagcgttgcccagattcattta
ctgctcacaacatggaaaattgatccattagaagttgatgtggcattagatcttcttgat
tataaattccctgataacaatgttcgaactattgctgtaaaagtgcttgataatttaacg
gatggtgaattggaaatgtatttactgcaacttattcaggcattgaaatatgaatcttac
ttggattcaccattagcaaagtatttactgaaacgtgctttaaataatcgacggataggc
cattacttgttttggcatttgaaagctgaggctggaaatcttgaatgttctttacagttt
ggtctattacttgaactatattgtcgtggtagcgttcaacatattgatatcttgacaaaa
caggttgaagcaattaataagatgaaaaccatgactgaatatcttcatcaatgtaaagat
caaagtaaagaagataaaatagaaatgatgcgaaatattttcaatggatcaagttacaaa
aaagctttttcagaaatagtgtctccactagatccaagtattaaactgaaatgtctcagg
gttgaaaaatgcaaatatatggattctaaaaaaaaaccactttggctagtgtttgaaaat
gttgatgaaggagcagatgatgttgttatcatttttaaaaatggagatgatttgcgtcaa
gatatgttaactgtattatcattgcgaatcatggataatgtctggaagaaagctggactt
gactatggtattattccatatcgatgtctttctactggtccaatgctcggattaattgaa
gtggtaccagaatctgaaacattaggtaagatacagtttgctcgtggtgcttttggtaca
tggaaagatgacactttttttttgtggctgaaagaccaatgtcaaggatcagatgagaaa
ttggaaaaatttatacagaacttcactagatcagttgttggttatagtattgctacatat
gtgttaggagttggtgatagacataatgataatataatgatgaagaaggatactggtcag
ttgtttcatattgattttggacattttctgggaaactttaagacaaagtttggattcaaa
agagagcgagttaaatttgttttaacttcagacattgtttatgtgattagcaaacatatg
aatatagatgacttcaaggacatgtgtattgttgctttcaagacgcttagaagtcgtgga
aatttattcattaccatttttgcgatgctgctgtcgactggaattccagagcttgaacat
cctaatgacatagaatacatacgtgagtccatggcgttaacgaaagatgaagcagatgcg
gttaaacattttgaaatgtcttacaaagaagcctacaataaccgagcttctactacatta
aattggagtcttcacaacgtagttcacaattggtaa

DBGET integrated database retrieval system