KEGG   Hydra vulgaris: 100210564Help
Entry
100210564         CDS       T01080                                 

Definition
ubiquitin carboxyl-terminal hydrolase 24-like
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100210564
Peptidases [BR:hmg01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100210564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1504 aa AA seqDB search
MNVLRYSCEKQIRLFVGLPDTTGVTQMLDKSGFSCFKAYFEDVNNDERKLLKNGPSILVE
KQDLIGLSYLLQLILESPYQSIADEASQYFINVSYLLLAPKMKKMDIRVIHQKFICECNM
KLDLLMSQLNETEQPELQDIKLLESKDHMLLKQLLFKQPFCFSIKLGPVISSLDTHGSSK
EEVHTKKLSSLLEKEKTLPSYILAMDCKIFDKLYQLAEIEEPRMTNALQNLLSRLPTDND
ILQAIEVFSTYNPWMSSPGKQAGYTKSSESVLENYFKCSAYRMSTFRVLYNLQKLLSSQE
TFGKSSAKSTSDLLTTVTEKFYHALDGGGDANAIALDISKVFDKVQHAVLSSKLMPVLDT
DSASMTYSFKENWLNAGGLSLIMNILLPDTLPSNADYELRQSCYYIILQLARFLLCGDSI
YEDNFVSASLAENTADSSIVRTFAETTVGNNTVSGNVRVESRSPGIATSTPIKVPNKIQI
ASSWPGVKNGGSPNTLNQISPSAATSSTSDNGTVRKRMRSTSVLDTNLNEAEFTETISSL
MQVAWAAGAGQLQLKAHNKSLSSIASLEGPSILKSGICLQQDFVSDMDSILCKNSLELLV
MCLQLRPNFLRVFYQLPDVVDFFIDLLTGSPSEQVRSATAHHFLALAQTSLNDSLIPSPK
IFILSTLMKIQLPFWNSSGTIRGLSFKLLSQSQNYFNLLCSLFQSLSVKEQETIGVDANQ
LLKCELQFLSSSDCATDLLHGHLMFANTLYSCEGVNCEETDQGFIRFLLDDFLFCASHLA
NNKSLSTVDLLDINMSYNNVKCRKEAFNLLLTLASKRHSNLQEIATDLQLRHHNELHSSE
WNTILKLEDVCQENILYHLQLIFGHLLESQQQFYSPELFWKNFKLWGEPVNVREQQDAFE
FFTNITDQLDENLNSLFKKKIFNNLFSGQFVDQKICSECSHCFECDEPFSSLPVTVKSGN
LEASLEQFVRKEVMEGENAYYCEKCCEHRTTVKRTCIKSLPPVLVFQLKRFWYDWERNRA
IKFDDFFSFPWILNIEPYTLEGITKKEKESAVINSNQMPPMRIVTNTKQYYELVGIVVHS
GQANAGHYYSFVKNRQNGNGAFEKWYKFNDVTVERFEMNDEALKIECFGGEYRVPQTDSS
YQYPENRIRTWNAYMLFYETMDKNRLPFVHSEYNSNEGRSYPGSPSSCCSSNPSSPGSKD
GLSLLSALIKKGERKGLFKDNMPSSIKRVSEKSIRKWNNVQKQEIVSLYFTIALLLLHSN
NTSKHVASSVFNCPPPQSLVIFCESLQMSVDIEEYFYGKPGQRFLIEIIQTSLELPQLIS
TVVDILVYGCWCNMEYSLTFLSEILILLTEAPVNDLKSAFELVKVILELGDGIQNNRVEI
FIDGSTEHNICGILKLIRSCHQDDAQRAYLCVKFLVRSDNKLVRNFLLQNSIKWQWAVEW
LKKKMSEFSMWSARSNTSNDNHTSFQRTNSAQNTLAEATKLLIETQSYNSSGYPNDAINE
DEVS
NT seq 4515 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttcttcgttatagttgtgaaaaacaaattcgtctgtttgttggtttgccagac
acaacaggtgtaacacaaatgttggataaatcaggcttcagttgcttcaaagcatacttt
gaggatgttaacaacgatgaacgtaagttactaaagaatggtccatcaattttggtagaa
aagcaagatctgattggtctttcatacttgttgcaattaatactagaatctccatatcaa
agtattgcagatgaagcatctcagtatttcataaatgtttcttatttattgcttgcccct
aaaatgaaaaagatggatattcgagttattcatcagaaatttatctgtgagtgtaatatg
aaacttgatttattaatgtcacagttgaatgagactgagcaaccagagcttcaagatatt
aagcttcttgagagcaaagatcacatgttactgaaacaattattgttcaaacaacctttt
tgctttagtataaagcttggtcctgtgatatcatcattggatacccatggatcatcaaaa
gaggaggtgcatactaaaaaactgtcaagtttgctggaaaaagaaaaaacattgcctagt
tacattttagctatggactgcaagatatttgataaactttatcagcttgcagaaattgaa
gaaccaagaatgacaaatgcacttcaaaatctgctttctcgattgcccactgataacgat
attctccaggctatagaagtcttcagtacctataatccttggatgtcttctccaggaaag
caagctggttatacaaaatcttcagaatcagttttggaaaattattttaaatgttccgca
tacagaatgtcaacattcagagttctatacaatttacagaagttactttcaagtcaagag
acttttggaaaatcttctgctaaatctacatctgacttgctaactactgtgactgaaaaa
ttttatcatgcattagatggaggcggagacgctaatgctattgctcttgacatatctaaa
gttttcgacaaagttcagcatgctgttcttagtagtaagctgatgcctgtattagacact
gattctgcttcaatgacatattcatttaaagaaaattggttaaatgctgggggtttgagt
ttgataatgaatattttattacctgacactttgccttcgaatgctgattatgaacttaga
caatcatgttactacattattttgcagttagcaagatttttattatgtggagattcgatt
tatgaggacaattttgtttctgcgagcttggcagaaaatacagcagatagcagtattgta
aggacatttgctgaaaccactgttggtaataacacagtgtctggaaatgttcgtgttgaa
tctcgttcacctggtattgctactagcactcctattaaagttccaaacaaaatacaaatt
gcatcatcatggcctggagttaaaaatggtggttcacctaacaccttaaatcaaatatca
ccaagtgctgcaacatcttctacatcagataacgggacagttcgcaaaagaatgagatca
acaagtgtgttggatactaatttgaatgaagcagagtttacagaaactatctcaagttta
atgcaggtggcatgggctgctggtgctggtcaacttcagcttaaagcgcacaacaaatca
ttgtcttcaatagcttcattagaaggaccaagtatattaaaaagtggtatatgtttacag
caagattttgtgtctgatatggattcaattttatgtaaaaacagtttggaactgcttgtc
atgtgtttacagcttcgacctaactttttaagagttttttaccagttacctgatgttgtt
gatttctttattgatttattgacaggatccccaagtgaacaggtacgctcggcaacagca
catcattttctagctctagctcaaactagtttaaatgattcattaatcccgtcaccaaaa
atatttatattatccaccttaatgaaaattcaattaccgttttggaattcgtctggaact
atacgaggactatcatttaaattgctgtcgcaatctcaaaattattttaaccttttgtgt
agcttatttcaatcattatcagtaaaagagcaagagacaattggtgtggatgctaatcag
cttctaaaatgcgagttacagtttttaagcagttctgattgtgcaacggatcttttacat
ggccatttaatgtttgcaaatacactatattcatgcgaaggagttaactgcgaagaaaca
gatcagggttttattcgttttttgttagatgattttttattttgtgcatctcacttggct
aataataaatcattgtctacagttgatttacttgatattaacatgagttacaataatgtc
aaatgtcgaaaggaagcattcaacttgttattaactcttgccagcaaacgtcacagtaat
cttcaggaaattgcaacagatttgcagctaagacatcacaatgaactgcattcatcagag
tggaatactatattaaaacttgaagatgtttgtcaagaaaatatactttaccatcttcaa
ctaatctttggtcatctgcttgaaagtcagcagcaattttattctccagagcttttttgg
aagaatttcaagctatggggtgaaccagttaatgttcgtgaacaacaagatgcgtttgag
ttcttcacaaatattactgatcaacttgatgagaacttgaactctcttttcaaaaaaaaa
atttttaataatttgtttagcggacaatttgttgatcaaaaaatatgcagtgagtgttct
cattgttttgaatgtgatgaaccattttcttcacttccagtgactgtgaaaagtggtaac
ttagaagcatcacttgagcagtttgttcgtaaggaggtaatggaaggagagaatgcttac
tattgtgagaaatgctgcgagcatcgtacaacagttaaaaggacttgcattaaaagttta
cctccagtgttagtttttcaattaaaaagattttggtatgattgggaaagaaaccgagca
atcaagtttgatgatttttttagctttccttggattttgaatattgaaccatacacacta
gaaggaataacaaaaaaagagaaagaatctgctgtcattaactcaaatcaaatgcctcct
atgaggattgttactaatacaaagcagtactatgaactagttggtattgtagttcacagt
ggtcaagcaaatgctggtcattattattcctttgtgaagaatcgccaaaatggaaatggg
gcatttgaaaaatggtataagtttaatgatgtcacagtagagagattcgaaatgaatgac
gaagcattaaaaattgaatgttttggtggagagtacagagtaccacaaacagattcaagt
tatcaatatccagaaaatcgtatccgaacttggaatgcttatatgttgttctatgaaacg
atggataaaaacagacttccgtttgttcattctgagtataacagtaatgaaggaagatcg
tatcctggtagtccttcatcttgttgcagttcaaacccttcatcacctggctctaaggat
ggattaagtttgctttcagctcttattaaaaagggagaacggaaaggactttttaaagac
aacatgccttcaagcattaagagagttagtgaaaaatctattcgcaaatggaacaatgtt
caaaagcaagaaattgtttcattgtattttacaatagcattacttcttttgcatagtaat
aatacatcaaaacatgttgcatcgtctgtattcaattgccctcctcctcaaagtttagta
atattttgtgagtctctacagatgagtgttgatattgaagaatatttctatggaaaacca
gggcaaaggtttttgattgaaattattcagacatcattagagttacctcaattaatcagc
actgtggtagatattttagtttatggatgctggtgtaacatggaatattctcttactttt
ttatctgaaattttgatacttttaaccgaagcaccagtaaatgatttaaagtctgctttt
gaattggtcaaagttattttagaattaggagatggtatccagaacaatagagttgaaata
tttatagatggttccacagaacataatatatgtgggattttaaaacttatccgctcgtgc
caccaagatgatgctcaaagagcgtatctatgtgtgaaattcctagttagaagtgacaac
aagttagtgcgcaattttttacttcaaaattcaattaagtggcagtgggctgttgaatgg
ttaaaaaaaaagatgagtgaattttcaatgtggtcagctcgctcaaatacctcaaatgat
aaccacacttcatttcagcgaaccaatagtgcacaaaacactcttgctgaagcaacaaag
ttactcatagaaacacaatcctacaatagttcaggataccctaatgatgctataaatgaa
gatgaagtttcataa

DBGET integrated database retrieval system