KEGG   Hydra vulgaris: 100210850Help
Entry
100210850         CDS       T01080                                 

Definition
putative glycerol kinase 3-like
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hmg  Hydra vulgaris
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hmg00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 504 aa AA seqDB search
MSYVGAIDQGTSSSRFLVFSAETGDLIASHQVETHSVYQQEGWCQQDPKEILDSVLLCIE
SVVSNMKQKGLDILQIKAIGITNQRETTIVWDSKTGEPLYPAIIWLDARTKETVEKLIEK
TADKSMSSFQKVCGLPFSTYFSGVKLRWLLDNCKDVCFAVKERRCLFGTVDSWLLWNLSG
GVDGGVHATDVTNASRTMLMNINTCKWDDDLCSFFQIPKEILPHIKSSSEIFGYMKCGSL
KGVVISGILGDQQAALVGQKCFSGGEAKNTYGTGNFLLYNTSKVPVFSEHGLLSTVAYQF
GPDEPPTFALEGSIAITGAAITWLRDQLGIIKSASETEALASSVKDNGNVYFVPAFSGLF
APYWDMSARGAIIGITQFTTKGHIVRAALEAVCYQTKEILEAMNKDSGIPLKQLIVDGGM
TANNFLMQMQADILGIEVARAIMPETTALGAAIAAGKAKGVDCWKASLTKNNFSYFKPKL
DEEARKNLYAKWKDAVKRTFSWEV
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgttggagcaattgatcaaggaacatcaagttcaagatttcttgtgttttca
gcagagacaggtgatttgatagcttcacaccaagtagaaactcacagtgtttatcaacaa
gaaggatggtgccaacaagatccaaaagaaattctagactcagttttactatgcattgaa
agtgttgtttccaatatgaagcaaaaaggtttagatattttacaaataaaagccattggt
atcaccaatcagcgtgaaactacaattgtttgggacagcaagactggagaacctctatac
ccagcaataatttggttagatgctaggactaaagaaactgttgagaaactaattgaaaaa
actgcagataagtcaatgagttcatttcaaaaagtatgtgggcttcctttttccacttat
tttagtggagttaagttgcgttggttgcttgataattgcaaagatgtttgttttgcagtt
aaagaaaggcgatgtctttttggcaccgtagattcctggttactttggaatttaagtggt
ggagttgatggtggagtacatgccactgatgtaactaatgcaagccgtactatgttgatg
aatattaatacatgtaaatgggatgatgatttgtgcagcttttttcaaattccaaaagaa
attcttcctcatattaaaagctcttcagaaatatttggttatatgaaatgtggttcacta
aaaggagtggtcatttcaggaatattaggcgatcagcaagctgcactggttggacagaaa
tgcttttctggtggagaggctaaaaacacctatggaactggtaactttcttctttataat
acaagcaaggtacctgtattttcagaacatggtttgttgtcaacagttgcatatcaattc
ggacctgatgagccacctacttttgctttggaaggctccatagcaattactggtgcagct
ataacatggttgcgtgatcaattaggaatcattaaaagtgctagtgaaacagaggcttta
gcgtcatcagtgaaagataatggaaatgtgtattttgttcctgcattttctggcttattt
gctccttattgggacatgtcagcaagaggggcaataattggcatcacgcagtttacaacc
aaaggccacatagtgagagcagcattagaagcagtttgttatcaaaccaaagagattttg
gaagctatgaataaagattctggtattccattaaaacaactaattgttgatggtgggatg
acagctaataactttttaatgcaaatgcaagctgatatacttggtatagaagtagcaaga
gcaatcatgcctgaaacaactgcactcggtgcagcaatagctgctgggaaagcaaaaggt
gtagattgttggaaggcatctctcaccaaaaataacttttcatattttaaaccaaaactt
gacgaggaagctcgcaaaaatttatatgctaaatggaaggatgcagttaaaagaacgttt
agttgggaagtttag

DBGET integrated database retrieval system