KEGG   Hydra vulgaris: 100211036Help
Entry
100211036         CDS       T01080                                 

Definition
uncharacterized LOC100211036
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
hmg  Hydra vulgaris
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100211036
Enzymes [BR:hmg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100211036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1413 aa AA seqDB search
MFEIRYFQYQSFNNLMAEPKVLKLYSPAYGEPIYYKWPLALTKKHDEAAEIIDTIKLVCE
DFPELRYAVDNVMLKDYDGQNYDSMNRLCQRYNKAIRNILTLWKGRAPPPRMFKPPNKEL
LRHIINLCYSHAIKDPEKLNSYEPFSPEVYGETSFDMIAQIIDDVPHSPDDIFIDLGSGV
GQVVLQAAASNQFKECLGVEKADIPAYYAVEMEKEFKKWMDWYGKIYTDFTLEKGDFMDK
KWQDSVNEAGFIFVNNFAFGPVVNHHLKNMFQSMKEGAKLVSSREFCSMNFKFNKRNLSE
LGAMMRISEIRPQNKASVSWTGNTVSYYLHVVDRTREGLDIEEDVSSIYSESNISNETNS
CANSGAFVNVETLEDNLDDLYLGTTTRHQWQLLTDTIKQSKKEAIGYVDQFKPTSKEQSS
GKQHSETKKNTLLRRSIARKSFESKKKLKKYSPENKKNLSNSSSSSSSMESDLDDPDFVG
GNEAKSIENSLDAEVESKLKYRLLDFIKIVNTKEYAEKLSSMIEFEKAKNKLLLREVDET
EAVIQNLINDGLKKFSQRLSELDIAVKTPLELLSRSSNLASKHRALENKVLNMECNDKVG
MKPCGEMLCDDLSTISNGGPGKNDVGTKVCYAIMNALNQRHLLISKNEHINEEIAILEKV
CTSAIPSVEQAVSDIKVTLPSAEIFLQAEKPTDKLDLIPKPRPVAFVPPRMLSCDKATIL
PVLTEQQLVLPPIISISPFSFLNSTLRNSFASEVNPQNKNNIQSETQGYKRSRGRPRKNV
QSSEKPITKKVKPVEKSLYHSHLSNDLSVISQYELHEPRVSSEEQKGEGSNCSSVVFPSK
PKGSIKLPKKLLKRSAEVEKEKFQKAQNIDESNTMKMEILNVSENYVLKKDVELNKCNAA
TNLIYSSSQIMLDEKQNRCQEKLYSSTIMQNSYDKLLFDSIASKSINNSSVDDYGNYLPK
ISNNLEQRLSASLDQIRQSVFVSNSLIRHPQQYVDRLSPTLQDHTTRACTHPQESSNINK
IAPEGWSGLTSKTPSELSVALSSSSMSKEQFIKPKDIICTNSDVINNPFYLKQDYQPRKV
INKPLNFKDDSIYKTSVVALQESYNHSKYDQSNARSALVDDHFYASLSHLVSSRISANET
SKTIPNIVNFTDQSKMTTKLQTTQNALTQSSSIYFPFTSNNQSTFCQKSINGDMRLINSV
NFPNSLSFNPLLKSMQEESHPTMTSQVTGSKLFKKLLTYSSDTNAAPITTSHNTSPKVSN
FHNPQYRLVYQPSVATDSQNSSFSTLNTFCLNSPISVQSDVKQNMVTPIPNNFIHSQVIS
WNMNSAALARVSLPTVCNTQVTPALDNILRNPSISNNTLQPMVYTTQPHLILLKPHLNEK
NSDTSLQTSFLSINQSASSPTYPPLEKLDDFKT
NT seq 4242 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaattcggtattttcagtatcaatcttttaacaacttaatggctgagccaaaa
gttttgaaactttatagtccagcctacggagaacctatttattacaaatggccgttagct
ttaactaaaaaacatgatgaagctgctgaaataatcgataccataaaattagtttgtgaa
gactttcctgaacttcgttatgctgtagataatgtgatgttgaaagactatgatggacaa
aactatgactccatgaatcgattatgtcagcgttataataaagcaatacgaaatatactg
actttatggaaaggacgtgcaccacctccacgaatgtttaaaccgcccaataaagaacta
cttcgtcatattattaatttgtgttacagccatgccatcaaagatcctgagaaactaaac
agctatgaaccattttcgccagaagtatacggtgaaacatcatttgatatgatagcacaa
ataattgatgatgttcctcatagtcctgatgatatatttattgatttaggaagcggtgtt
ggccaagttgttcttcaagcagcagcatcaaaccaatttaaagaatgtttaggtgtagag
aaagctgatataccggcatactatgctgtagaaatggaaaaggaatttaaaaaatggatg
gattggtatgggaagatatacacagatttcactctagaaaaaggagattttatggataag
aagtggcaggactcagtaaatgaggctggatttatctttgttaataattttgcttttggt
ccagttgttaatcatcatttaaaaaatatgtttcagtcaatgaaagaaggtgcaaaatta
gtttcgtcaagggagttttgttcaatgaattttaaatttaataagcgaaatttatctgaa
ctcggtgctatgatgcgaataagtgaaattcgtcctcaaaacaaagcgtcagtatcgtgg
actggaaacactgtctcatattatttacatgttgttgatcgaacaagagaaggtcttgat
attgaagaagatgtcagttctatatattcggaaagcaacattagtaacgaaacaaatagt
tgtgcaaactcaggagcttttgtcaatgttgaaacgcttgaagataatttagatgaccta
taccttgggacaacaactagacaccaatggcagttactaacagataccataaaacaaagt
aaaaaagaagctatagggtatgtagatcaatttaagcctactagtaaagagcaaagttct
ggaaagcaacattcagaaaccaaaaagaatactttattgcgtagaagtattgcaagaaaa
tcttttgagtcgaaaaaaaaactaaagaaatacagtccagagaacaaaaagaacttatct
aattcatcttcatcaagttcttctatggaaagtgatcttgatgacccagattttgtagga
ggtaatgaagcaaagtccattgaaaactcgcttgacgcagaggttgaaagtaaattaaag
tatcggttattagattttataaagatagtaaatacaaaagaatatgctgaaaaacttagt
tcaatgattgagtttgaaaaggcaaaaaataaattattacttcgagaagttgatgaaaca
gaggcggttattcaaaatctcattaatgatggactaaaaaaattctcacaacgtctttca
gaacttgacatcgctgtaaaaacaccattagagctgctctcaagatcttcaaatttagct
tcgaagcatcgtgctcttgaaaataaagttcttaatatggagtgcaatgataaagttgga
atgaaaccatgtggagaaatgttgtgtgatgatctttctacaatttcaaatggtggacca
ggaaagaatgatgtaggtacaaaagtttgctatgctattatgaatgcactaaatcaacgt
cacctgctgataagcaaaaatgaacatataaatgaagagatagcaatacttgaaaaagta
tgtacgtctgctattccgtctgttgagcaagcagtatctgatatcaaggttactttacct
tcagcagaaatatttttacaagctgaaaagcctacagacaagcttgatcttatacccaaa
ccacgtcctgttgcctttgttccaccacgtatgctaagttgtgataaggcaacaatttta
ccagtacttacagagcaacaattagttttgccccccattatctcaattagtccatttagt
tttttgaactctactttaagaaacagctttgcatctgaagtaaatcctcaaaataaaaac
aatatacaatcagaaacacaaggttataaacgttcaagaggacgacccagaaaaaacgtt
cagtcttctgaaaagccaatcactaaaaaagtcaaacctgttgaaaaaagtttgtatcat
tcacatttgtctaatgatctttctgtcatcagccagtatgaattacatgaacctagagtt
tcttcagaagaacaaaaaggagaaggaagtaattgttcttcagtagtttttccaagtaaa
ccaaaaggctcaattaaactccctaaaaaattgttgaaaagaagtgcagaagttgaaaaa
gaaaagtttcaaaaagctcagaatatagatgaatcaaatacaatgaaaatggaaatctta
aatgtttcagaaaattatgttttaaaaaaagatgttgaattaaacaagtgcaatgcagct
actaatttgatttattcttcctcacaaataatgcttgatgagaaacaaaatcgatgtcaa
gaaaaactgtactcttcaacaataatgcagaacagctatgataaattgttattcgatagt
attgcttctaaaagtattaataatagttctgtagatgactatggaaattatttaccaaaa
atttcaaataatcttgaacaaagactaagtgcttcgcttgaccaaattagacagagtgtt
tttgtctcaaattctttaattcgtcatccacaacaatatgtagataggttaagccctaca
ctacaagatcacacaaccagagcttgtacccatcctcaagaaagttctaacataaataaa
atagctccagaaggttggagtgggttaacttctaaaactccaagtgagttatctgttgct
ttgtccagttcatctatgagtaaggagcaatttattaaacctaaagatataatttgcact
aactcagatgtcataaacaatcctttttatctcaaacaagattatcaacctcgaaaagta
attaataagccattaaattttaaagacgattcaatctataaaacttctgtagttgcattg
caagaaagttataatcatagtaagtatgaccaatccaatgctcgatctgctctagttgat
gatcatttttatgctagtctcagtcacttagtttctagtcgaatttctgcaaatgaaaca
agcaaaactatccctaatatagtaaattttacagatcaatctaaaatgacaactaaacta
caaactactcagaatgctttgactcaatctagctcaatatattttccatttacttctaac
aatcaatcaacattttgtcaaaagtcaataaatggtgacatgcgacttataaactcagtt
aattttccaaactctttatcttttaatcctttactaaaatcaatgcaagaagaatctcat
ccaacaatgacatctcaagttacaggatcaaaactatttaaaaaactactcacttattct
agtgatactaatgcggcacctatcacaacttcacataatacaagtcctaaagtatcaaac
tttcataaccctcaatatcgattagtttatcaaccaagtgttgccacagattctcagaat
tcctcattctcaacacttaacactttttgcttaaacagtccaatcagtgttcaatctgat
gttaaacaaaatatggtaactccaataccaaataacttcattcactcccaagttattagt
tggaatatgaattcggcagctcttgcaagagtttcactaccaactgtttgtaacacacag
gttacgcctgcactagataacatattaagaaacccttctatatcaaataatacattacag
ccaatggtttatactacgcaaccgcatttgattctattaaaacctcatttaaatgaaaaa
aacagtgatacttcgttgcaaacttctttcttgagtataaatcaatcagcatcttcacca
acatatccaccattagaaaaattagatgattttaaaacttag

DBGET integrated database retrieval system