KEGG   Hydra vulgaris: 100211063Help
Entry
100211063         CDS       T01080                                 

Definition
(RefSeq) enoyl-CoA hydratase, mitochondrial-like
  KO
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
hmg  Hydra vulgaris
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100211063
   01212 Fatty acid metabolism
    100211063
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100211063
   00650 Butanoate metabolism
    100211063
  Lipid metabolism
   00062 Fatty acid elongation
    100211063
   00071 Fatty acid degradation
    100211063
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100211063
   00310 Lysine degradation
    100211063
   00380 Tryptophan metabolism
    100211063
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100211063
Enzymes [BR:hmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100211063
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 287 aa AA seqDB search
MLKVLLGNSVHKRLPFLCQRFYQTYKQSSYDNILVEIAGEKNNVGVIRLNRPKSLNALCN
ALFNDLSQALKSFEADNSIGAIVLTGSDKAFAAGADIKEMQNKEYADVLGGSFLSHWDCI
TQCTKPIIAAVNGFALGGGCEVAMMCDIIYAGDKAKFGQPEILLGTIPGAGGTQRLARAV
GKSKAMEMCLTGVPINAQEALQFGLVSKVVPADQLVDETVKTASLIAANSKLITALCKEA
INKGFELPLKEGCHLEKRLFHATFGTLDRKEGMDAFVEKRKASFKDK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaagtattattgggcaactctgttcataaaagactgccattcttgtgccaaagg
ttttatcaaacatataaacaatctagctatgataacattttggttgaaatagctggcgaa
aaaaacaatgttggtgtgattcgtttgaatcgtccaaagtcacttaatgccctttgcaat
gctttgtttaatgatttatctcaagcattgaaaagcttcgaagcagataacagcataggg
gctatagttttaactggtagtgataaagcatttgctgctggtgcggatattaaggagatg
caaaataaagaatatgcagatgtccttggcggttcttttctcagtcattgggactgtata
actcaatgtactaaaccaataatagctgctgtcaatggttttgcattaggaggtggatgc
gaggttgctatgatgtgcgatattatttatgctggcgataaagcaaagtttggtcaacca
gaaattttgcttggtactattcctggtgctggtggcacacaacgtttagcaagagctgtt
ggaaaatctaaagctatggaaatgtgtcttactggagttcctataaatgctcaagaagct
cttcagtttggtttagttagtaaagtagtacctgcagatcaacttgttgatgagactgtg
aagactgcatctcttattgcagccaattcaaagcttattactgctttatgtaaagaagct
attaacaaaggttttgaactgcctcttaaagaaggttgtcaccttgaaaaaagacttttt
catgccacatttggaactcttgatagaaaagaaggaatggatgcatttgttgaaaaaaga
aaggcgtcatttaaagacaagtag

DBGET integrated database retrieval system