KEGG   Hydra vulgaris: 100211141Help
Entry
100211141         CDS       T01080                                 

Definition
(RefSeq) pyruvate dehydrogenase (acetyl-transferring) kinase isozyme 2, mitochondrial-like
  KO
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100211141
Protein kinases [BR:hmg01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100211141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 407 aa AA seqDB search
MMRFAKAISGDVQKYINRYSRYHQSILTIEQFTHFGKNAEPLGSYKFLRNEVPVRLAHIM
QEISHLPKNLLSMRSVDLVRSWYVQSFIDLMEFQDAPFNVDTVDRFTKTLHAIKRRHDST
VETMAQGIIELKESEGESCFLPAVQYFLDRFYMNRIGIRLLISQHLALFKENLNDSSEKF
IGVFEPNCCVKTILKDAIENASFLCEQSYFVFPQVMINEVNTLSKGSEIYINYVPSHLYY
ILFEILKNAMRATVESHKNSDDLPSIQATIVKGNEDLTIKISDEAGGIPRSNIEKLFAYH
YSTAPEPNKTTHGSPMAGYGYGLPLSRLYAKYFGGDLQIVSMDGLGTSAYIYLKTLSHDA
HEVIPSYNSSVAKASYENSNSAQSNTRDWSSNSFYEKTKSFAKPSQK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggtttgcaaaagcgatcagtggggatgtgcaaaagtacataaatcgctatagt
cggtatcatcaatctattttaacaatagaacagttcactcattttggaaaaaatgcagag
ccgcttggttcatataaatttctgcgcaatgaagttcctgttcgtttagctcatataatg
caagaaattagtcatttaccaaaaaatctattatcaatgcgttcagttgaccttgttaga
agctggtatgttcaaagtttcattgatcttatggagtttcaagatgctccttttaatgtt
gatactgtagatagatttactaaaaccttgcatgctataaaacgtcgtcatgacagtaca
gttgaaacaatggctcagggtattattgaattaaaagaatcagaaggtgaatcttgtttc
cttcctgcggtccagtattttttagatcgcttttatatgaataggattggaattcgtctt
cttatatcacaacatttggcgctgtttaaagaaaatcttaatgacagttctgaaaaattt
attggggtgtttgaacctaactgttgtgttaaaactatacttaaagatgccatagaaaat
gcaagttttctatgtgagcagtcatattttgtatttcctcaagttatgatcaatgaagtc
aacacattatcaaaaggttcagagatttacataaattatgtcccatcacacttgtactat
attctgtttgagattttaaagaatgcaatgcgtgcaactgtagagtctcacaaaaattct
gatgacctgccaagtatccaagcaacaattgttaaaggtaatgaagacttgacaataaaa
atatcagatgaagctggaggaataccacgaagtaatatagagaaactttttgcttaccat
tatagcacagctcctgaaccaaataaaactacccatgggtctccaatggctggatacggt
tatggtcttccattatcacgactttatgctaaatattttggaggagatcttcagattgtt
tctatggatggtcttgggacttctgcttacatatatttaaaaactctatctcacgatgct
cacgaagttataccgtcgtataatagttcggttgcgaaagcttcttatgaaaatagtaat
tcagctcagtctaatacgagagattggtcttctaattcattttacgaaaaaacgaaatcg
tttgcgaaacccagccagaaataa

DBGET integrated database retrieval system