KEGG   Hydra vulgaris: 100211141Help
Entry
100211141         CDS       T01080                                 

Definition
pyruvate dehydrogenase [lipoamide] kinase isozyme 2-like
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
hmg  Hydra vulgaris
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 395 aa AA seqDB search
MVDIFQAFITVENLQMENPFALDGKNAEPLGSYKFLRNEVPVRLAHIMQEISHLPKNLLS
MRSVDLVRSWYVQSFIDLMEFQDAPFNVDTVDRFTKTLHAIKRRHDSTVETMAQGIIELK
ESEGESCFLPAVQYFLDRFYMNRIGIRLLISQHLALFKENLNDSSEKFIGVFEPNCCVKT
ILKDAIENASFLCEQSYFVFPQVMINEVNSKFYISEIYINYVPSHLYYILFEILKNAMRA
TVESHKNSDDLPSIQATIVKGNEDLTIKISDEAGGIPRSNIEKLFAYHYSTAPEPNKTTH
GSPMAGYGYGLPLSRLYAKYFGGDLQIVSMDGLGTSAYIYLKTLSHDAHEVIPSYNSSVA
KASYENSNSAQSNTRDWSSNSFYEKTKSFAKPSQK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacatttttcaagcatttattacagtagaaaacttgcaaatggagaaccctttt
gccttagatggaaaaaatgcagagccgcttggttcatataaatttctgcgcaatgaagtt
cctgttcgtttagctcatataatgcaagaaattagtcatttaccaaaaaatctattatca
atgcgttcagttgaccttgttagaagctggtatgttcaaagtttcattgatcttatggag
tttcaagatgctccttttaatgttgatactgtagatagatttactaaaaccttgcatgct
ataaaacgtcgtcatgacagtacagttgaaacaatggctcagggtattattgaattaaaa
gaatcagaaggtgaatcttgtttccttcctgcggtccagtattttttagatcgcttttat
atgaataggattggaattcgtcttcttatatcacaacatttggcgctgtttaaagaaaat
cttaatgacagttctgaaaaatttattggggtgtttgaacctaactgttgtgttaaaact
atacttaaagatgccatagaaaatgcaagttttctatgtgagcagtcatattttgtattt
cctcaagttatgatcaatgaagtcaacagtaagttttatatttcagagatttacataaat
tatgtcccatcacacttgtactatattctgtttgagattttaaagaatgcaatgcgtgca
actgtagagtctcacaaaaattctgatgacctgccaagtatccaagcaacaattgttaaa
ggtaatgaagacttgacaataaaaatatcagatgaagctggaggaataccacgaagtaat
atagagaaactttttgcttaccattatagcacagctcctgaaccaaataaaactacccat
gggtctccaatggctggatacggttatggtcttccattatcacgactttatgctaaatat
tttggaggagatcttcagattgtttctatggatggtcttgggacttctgcttacatatat
ttaaaaactctatctcacgatgctcacgaagttataccgtcgtataatagttcggttgcg
aaagcttcttatgaaaatagtaattcagctcagtctaatacgagagattggtcttctaat
tcattttacgaaaaaacgaaatcgtttgcgaaacccagccagaaataa

DBGET integrated database retrieval system