KEGG   Hydra vulgaris: 100211402Help
Entry
100211402         CDS       T01080                                 

Gene name
acss2
Definition
(RefSeq) acetyl-coenzyme A synthetase, cytoplasmic
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hmg  Hydra vulgaris
Pathway
hmg00010  Glycolysis / Gluconeogenesis
hmg00620  Pyruvate metabolism
hmg00640  Propanoate metabolism
hmg01100  Metabolic pathways
hmg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100211402 (acss2)
   00620 Pyruvate metabolism
    100211402 (acss2)
   00640 Propanoate metabolism
    100211402 (acss2)
Enzymes [BR:hmg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     100211402 (acss2)
Lipid biosynthesis proteins [BR:hmg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   100211402 (acss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N Herpes_US9
Motif
Other DBs
NCBI-GeneID: 100211402
NCBI-ProteinID: XP_002165473
Position
Un
AA seq 697 aa AA seqDB search
MESTLEILSSNKNHAIFSRALSFTEELGTNLLFKCNPDSFKNAHVTSMEQYSSMYKESIE
NPEKFWTNIADDFFWKYKWTGKFMDYNFDLSKGNVFVKFMEGGKTNICYNVLDRIVNEKK
LGDKVAFYWEGNEFSESKKYTYSDLLKEVCKFANVLKEKGIKKGDRVAIYMPMIIELVVA
MLACARIGAIHSIVFAGFSADSLADRMIDGQCSILITADGGCRGTKELDLKSVADVAIAE
CAEAGLVVSLCIVVKNIKTNLFDECSSTKRSKDGTTSWNSNIDVWWHDVMENVNDECECE
WMDAEDPLFILYTSGSTGKPKGVVHTVGGYMIYTATTFKYTFDYHNEDIYWCTADIGWIT
GHSYIVYGPMANGATSVLFEGLPIYPDAGRMWSICEKYRVSKFYTAPTAIRLLMKYGREF
VKKYDRSSLTVLGTVGEPINPEAWLWYYNVVGEERCYIVDTFWQTETGGHMITGLPGVTP
MKPGSASLPFFGVVPAIVDEEGKEYEKTIVDHGFLVFKQPWPGMMRTLYNNHSRYESAYF
ERFKGYYCAGDGCNRDEDSYYWITGRIDDLMNVSGHLLSTAQIESALIEHSSVAEAAVVG
FTHSIKGTGIYCFVTPKNGIRFCDALVSELNEKVRARIGPIATPDFIQCAPGLPKTRSGK
IMRRILRKIADGDRDVGDTTTLADPNVVEELFKNKPN
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaacattagaaattctttcaagtaataaaaatcacgctatattttcacgagct
ttatcatttacagaagaacttggtactaatcttttatttaaatgcaatccagattctttt
aaaaatgcacatgttacttcaatggaacaatatagtagcatgtataaagagtctatagaa
aatcctgaaaaattttggacaaatattgctgatgattttttctggaaatataaatggacc
gggaaatttatggattacaactttgatttgtcaaaaggaaatgtttttgtgaagtttatg
gagggaggaaaaactaatatatgctataatgtccttgatagaattgttaatgaaaagaaa
ctaggagataaagttgcattttactgggaaggcaacgaatttagcgagtcaaaaaagtat
acgtattcagatttactgaaagaggtttgcaagtttgcaaatgttttgaaagaaaaagga
attaaaaaaggcgatcgtgtggctatatatatgccgatgatcattgaattagttgtcgca
atgttggcatgtgctagaattggagccatccattcaatagtttttgcaggtttttctgct
gactcgcttgcagatagaatgattgatggtcagtgctctatattaatcacagcagatggt
ggttgtcgaggaactaaagaacttgacctaaaatcagttgctgatgttgctattgcagaa
tgtgcagaagctggacttgttgtttcattgtgtattgttgtcaaaaatataaaaacaaat
ctttttgatgaatgctcctcaacaaagagatccaaggacgggactacaagttggaattct
aacattgatgtttggtggcatgatgtaatggaaaatgttaatgatgagtgcgaatgtgaa
tggatggatgccgaagatcctttatttatattatatacaagtggttcaacaggcaaacca
aaaggagttgtgcatactgtcggaggatatatgatttacacagctactacatttaagtac
acatttgattaccacaatgaagatatctattggtgtactgctgatatagggtggattaca
ggacattcttatattgtttatggtccaatggctaatggcgcaacaagtgttttattcgaa
ggtctcccaatttatccagatgctggtcgaatgtggtccatttgtgaaaagtatcgagtc
tctaagttttatactgcgccaactgccattcgattgttgatgaagtatggaagagagttt
gtcaagaagtatgatcgatcaagtttaactgttcttggtactgttggagaacccattaat
ccagaagcatggttatggtattataatgtggttggtgaagaaagatgctatattgttgac
acattttggcaaacagagactggaggtcatatgatcacaggattgcccggagtaactcct
atgaaaccaggatcagctagtttaccgttttttggtgtggtgccagctattgttgatgaa
gaagggaaagaatatgaaaaaacaatcgtagatcatggttttttggttttcaaacaaccc
tggcctggtatgatgcgcacattatataacaatcattcaagatatgaaagtgcttatttt
gaacgctttaaaggttattactgtgcaggcgatgggtgcaatcgagatgaagacagctac
tattggattacaggtcgaattgatgatctaatgaatgtatctggtcatttattaagcacc
gcacaaattgaaagtgcgctgattgaacattcttcggtagctgaggctgcagttgttgga
tttacacacagtattaaaggaacaggaatttattgctttgtaacccctaaaaatggaatt
cgtttttgtgacgctctcgtatcagagttaaatgaaaaagttcgtgctcggattggacca
attgctacgccagattttatccagtgcgctccgggtttgcccaagactcgttcgggtaaa
ataatgcgacgtatattacgtaaaattgcagatggtgaccgtgacgttggagatacaaca
actttagcggacccaaacgtggtcgaggaactttttaagaataaacctaattaa

DBGET integrated database retrieval system