KEGG   Hydra vulgaris: 100211421Help
Entry
100211421         CDS       T01080                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 4-like
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100211421
Protein kinases [BR:hmg01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   100211421
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 595 aa AA seqDB search
MSSQHNHFEENHVLIQRNATYAVLQPTFLHHQPKRCYANGVLVKLPSMLSLASIQLKVAG
KSRVSSSLFDSEKSSKEKKSSKAEKWPLTAGVAMKLYRNQLTLFEHTEILDYPEIWYLGL
EARKIEGVSGALMNNGYDDEQGGFIRVVKDHISYRYEIIDTVGKGSFGQVIKAYDHKCKE
FVAIKVIRNKKRFHHQALVEVKILDLLRKKDPDMLYNIIHMKDYFYFRNHLCISFELLGM
NLYELLKKNNFQGFSLDLVRKFAVSILLCLRLLYYNHIIHCDLKPENILLEKHGSTSVKV
IDFGSSCLEHQKVYSYIQSRFYRSPEVILGISYSTAIDMWSLGCILAELHTGLPIFPGEN
EIEQMACIMEIFGSPPITLIENSQRRRFFFDSKGNPRAFTNSKGKKRWPSTKDLNSSLKS
NDPLFIDFIQRCFEWDPSKRMNPDEALQHSWLSDVGYNAVSSSCRIKYNTISSPCHLNAY
SAESEKLHVLNLRTKDEYKTYYTVQRRNLIYRHGNVSAENDESNIFRSNSIIRHTQSLQS
IDEFRNFGFLNSNTVDCCLPSDKVTKKDVLKTMSDQINLSNWSIRDKDNILPPIR
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcccaacacaatcattttgaagagaatcatgtacttattcaaagaaatgcaacc
tatgctgttcttcagcctacttttctacatcatcagcctaagagatgctatgcaaatggt
gtacttgttaagctccctagcatgctttcattagcatccattcagctcaaggttgcaggt
aaaagtcgtgtcagcagttcgttatttgatagtgaaaaaagttctaaagaaaaaaaatca
agtaaggcagaaaaatggccattgactgcaggagtggctatgaagttgtacaggaatcag
ttaactttgttcgaacatactgaaattctcgattatccggagatatggtatttaggtttg
gaagcgagaaaaattgaaggggtttccggcgcactaatgaataatggatatgatgacgag
caaggaggttttatacgagtagttaaagatcatatatcttatcgttacgaaattattgat
actgttggtaaaggatcttttggacaagttattaaagcttacgatcacaaatgcaaagaa
tttgttgctattaaagttatacgaaacaaaaagcgatttcaccatcaagctttagttgaa
gtaaagatacttgatttattgagaaaaaaggatcctgacatgctttataatattattcat
atgaaagattacttttacttcaggaatcatttgtgcatttcttttgagctgcttgggatg
aacctttacgagttattaaagaaaaataattttcaaggattcagcctagatttggtgcga
aaatttgctgtctctatactgctttgccttcgtttgctttattacaatcatatcatccac
tgtgatttaaaacctgaaaacattctgcttgaaaagcatggatcgacatcggtcaaggtg
atcgatttcggttcaagctgcttggaacatcagaaagtttacagttatattcaaagtaga
ttttatcgctctcctgaagttatattgggtatttcgtattctaccgctattgacatgtgg
tctctcggttgtatacttgctgaattacacactggtttaccgatatttccaggtgagaat
gagatcgagcagatggcttgcattatggagatatttggatcgcccccaataactttaatt
gaaaactcgcagaggagaaggttttttttcgattcgaaaggtaatcctcgtgcttttaca
aactctaaagggaaaaaaagatggccttcaacgaaagatttaaattcgtccttaaaatcc
aatgatcctctttttatagattttattcagcgttgttttgagtgggatccttcgaagcgc
atgaatcctgatgaagcacttcagcacagttggttgtcagatgtcggatataacgccgta
tcgtcttcttgccgtataaaatataataccatatcgtcgccttgtcatttaaatgcttac
tcagctgaaagtgaaaagttgcatgttttaaatcttcgtaccaaagacgagtataagacg
tattatactgtacaaagacgaaatcttatctatcgtcatggtaatgtatcagcagaaaat
gacgaaagcaacatatttagaagtaatagcattattagacatactcaaagtcttcaatca
attgatgaattccgaaattttggttttttaaattctaatacagtagactgctgtctccct
agtgacaaagtgaccaaaaaagatgttttaaagacaatgagtgatcaaattaatttatct
aattggtctattcgagataaagataacattttgccacccattagataa

DBGET integrated database retrieval system