KEGG   Hydra vulgaris: 100211920Help
Entry
100211920         CDS       T01080                                 

Definition
general transcription factor IIH subunit 4-like
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
hmg  Hydra vulgaris
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100211920
  Replication and repair
   03420 Nucleotide excision repair
    100211920
Transcription machinery [BR:hmg03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100211920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 458 aa AA seqDB search
MTDISKKKKLDCKDLYGYLLTLSPSSLNALYNDPFTCLAVFRGLPELAKHYIMRTLFTNQ
SLSDAFVLSWCKKEWAKDHIEAVNKLKGLHIWVSFEIGTPMLRYEFNITFQTNLRIGLCG
GGPVQATPLKAVEEKHARDVAFLDNYSKERWECILYYMTGSQVTGNAGVSQDVARVLINA
GLLIFDHQEQATCITSSGFQFLLLDTSSQVWYFMVQHLNSMEPEILVQCLSFLFQTSFSV
LGKDYPVNDLTEAQFSFLQLLREIGLAFQRKRKSKRFYPTRLAINLGSAVTGNSDSSSQQ
QGFLVVETNYRVYAYTDSVLHIALLSLFTDIKARFPSFTVALLSRESVQQALACGISAEQ
IIDFLKTRAHSQMTTSSPIIASTITDQIKLWEMERDRLRYSQGVLYNQFLSQSDFEMLRK
FADEKNHLLWANNQKRLMVVSKSGHEDVKKYWKRNKPS
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgacagatataagtaaaaagaaaaagttagattgtaaagacttatatggctacttgctg
acactctcaccaagttcactcaatgctctgtataatgatccgttcacatgtcttgcagtt
tttagaggtcttccagaattagcgaaacattatattatgcggactttatttacaaaccaa
tctttatcagatgcatttgttttatcatggtgtaaaaaagaatgggctaaagatcatata
gaagcagtaaacaaactgaagggattacatatatgggttagttttgaaataggaactcca
atgttacggtatgaatttaatattacttttcaaacaaatttaagaataggactttgtgga
ggaggtcctgttcaagcaacacctttaaaagcagttgaagaaaaacatgctcgggatgtt
gcatttctagataattattcaaaagaaagatgggaatgtattttatattatatgactgga
tctcaagttactggaaatgcaggtgttagtcaagatgttgcacgtgttcttataaatgct
gggttactcattttcgatcaccaggaacaagcaacttgcataacttcatcaggatttcaa
tttttacttttagacacctcttcacaagtatggtactttatggttcaacatttaaactct
atggaaccagaaattcttgttcaatgtttatctttcttatttcagacaagcttttcagtt
cttggcaaagattatccagttaatgacttaacagaagctcaattttcatttttacaacta
ttacgtgaaattggcttagctttccagcgtaaaagaaaatctaaacgcttttatccaaca
agattggccattaatctgggctcagctgttaccggtaatagtgattctagttcacaacag
caaggttttttagttgttgaaactaactatagggtatatgcatatactgactcagttctt
cacattgctttgcttagcttgtttacagatattaaagcacgctttccaagttttactgta
gctttactaagccgtgagagtgtacagcaagcattagcatgtggaatatctgctgaacaa
ataattgactttttaaaaactcgagcacactcacaaatgacaactagctcaccgattata
gcttcaacaatcactgatcagataaaactgtgggaaatggaaagagacaggttgcgttat
tctcaaggtgttttgtacaatcagtttctttcacaaagtgattttgaaatgctgcgaaag
tttgcagatgaaaaaaatcatttattgtgggcaaataatcaaaaacgtttaatggttgta
tctaagtctggtcatgaagatgtaaaaaaatactggaagcgtaataaacctagctag

DBGET integrated database retrieval system