KEGG   Hydra vulgaris: 100212624Help
Entry
100212624         CDS       T01080                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase, mitochondrial-like
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
hmg  Hydra vulgaris
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100212624
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100212624
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100212624
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100212624
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     100212624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 381 aa AA seqDB search
MFSPINVRILKNCSKLPFRFFSVTKNLCSNSEDEVLFEIHNRTGLITLNRPKALNALNLN
MVRTIHPVIKEWESNPLIEAIVMKGAGSKAFCAGGDVRAIAEGGPGCELSQVFFREEYRL
NSEIGNLKTPFVALIDGITMGGGVGLSVHGKNRVASENTLFAMPETAIGFFPDVGGGYFL
PRLKGKLGLFLALTGHRLKGRDVYFAGIATHYVTANQIPYLEEEILKLNKPADRIQELLN
SYHKKCDDYNTHFSLNQHLETIDNTFSAPTLEEIFLRLQENKSDWSKKQFEVLKKLSPLS
LKVTMKQIEKGAALSLNDVLKMEYRISQRFMEGRDFFEGIRSVLVDRDNSPKWQHKSLDE
VSEDLVSSFFTSLPFGRELTI
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgttttctcctataaatgtcagaatattgaagaactgttcgaagttaccattcagattc
ttttcagtaacaaaaaatttgtgcagcaactcagaagatgaagttttattcgaaatccac
aatcgaactggtttgataactttgaacagaccaaaggctttaaatgctttaaatttaaat
atggttcgaactatacatccagtcattaaggagtgggaaagcaatccattaattgaagcg
attgttatgaaaggtgctggtagcaaagcattttgtgctggaggagatgtcagagcaatt
gcagaaggtggtccaggatgtgagttatcacaagttttcttcagagaagaatatcgatta
aactcagaaatcggaaatcttaaaacaccatttgtagctctaattgatggaattacaatg
ggtgggggtgttggtttgtcagttcacggaaagaatcgtgtagcatccgaaaataccttg
tttgctatgccagagactgctataggtttttttcctgatgttggaggtggctattttttg
ccaaggttaaaaggaaagctcggtttgtttttagctcttacaggacatcgattaaaagga
agagatgtttattttgctggcattgcaactcattatgttactgctaatcaaattccatat
ttagaagaagaaattttgaaattaaataaacctgcagacagaatacaagaacttttaaat
tcataccataaaaagtgtgatgattacaatacacatttctcgttaaatcaacatttagaa
acaattgataatacattctcagcccccacattagaggaaatatttttacgtttacaagaa
aataagtccgactggtctaaaaaacaattcgaggttcttaaaaagttgagtccgttatct
ttaaaagtcacaatgaaacaaattgaaaaaggagcagcgttgagtttaaatgatgttctt
aaaatggagtatcgtatttctcaaagatttatggaaggacgcgacttctttgagggaatt
cgctctgtgctggtagatcgtgataattctccaaaatggcagcacaagtctttagatgaa
gtttcagaagatttagtttcctccttttttacttcattgccgttcggcagagaacttaca
atttag

DBGET integrated database retrieval system