KEGG   Hydra vulgaris: 100213041Help
Entry
100213041         CDS       T01080                                 

Definition
(RefSeq) regulatory-associated protein of mTOR-like
  KO
K07204  
regulatory associated protein of mTOR
Organism
hmg  Hydra vulgaris
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100213041
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1308 aa AA seqDB search
MYGNVELDDINEEGNEEEDNVLDWQLPICFMKKRHKEKIEGTTFSPQTWKMKEKMKTVSV
NLVLCLNIGVDPPDIVKTNPCARMECWIDPLSLNPQKALELIGNKLQEQYERWQPRARYR
HNLDPTVEDVKKLCTSLRRNAKEERVLFHYNGHGVPRPTANGEIWVFNKQYTQYIPLSIY
DLQTWMGSPSIYVYDCSNAGLILECFKHFAQQREQEYERASAQGSNPGLPPLVNNCIQLA
ACGPNELLPMMPDLPADLFTSCLTTPIKVALQWFVSQRMGNLVPGITVDLIEKIPGQLND
RRTPLGELSWIFIAVTDTIAWLTLPIELFQKLFRQDMLVASLFRNYLLAERVMRSYCCTP
VTSPKLPPMYHHHMWLAWDLAVDQCLSQLPVIIEDINKYKNSTFFYEQLTAFQVWLAMGR
EDREPPEQLPVVLQVLLSQVHRLRALDLLGRFLDLGPWAVNLALSVNISPYILRLLRSPT
RELRPLLVFILAKILAVDSSFQTDLVQENGHKYFLSVLADGYMPAEHRTTASFVLARIVH
DYPAGQEACLKGNMISICLEQLTDPHPLLRQWLALCLGLIWKNCDAARWCGIRDSAPDKI
SKLLPDPLPDVRAAAVFALGTLIGNTGDRSDHANMIDQSVATTLTTMLANEGSPLVRKEL
VVALYSHIMQFENAFIGVAVQFMDDSSLHDSSGPGPRDPETKKGWILVPQSSDANISANE
PSYSKKSSGQTLLHSSRSSISLSSMYGSVSPTDDSHWFRTQIFTSSLHETVYTRVWKAML
NLSMDPHTETADMARKVVNTIAVKAAVNIKPHNGSTSVSTNVSLPSSPNTSDEGASIHPR
HSIGEFHRSTSFPSTPEQYLKKQASIPTSLYRPHSVQFSTKRGIFDKGPDVFPTSDDDSD
ADEDGISMHKHILVRTKFYEWCCGYFAHSLMKPSDDVDPNSAQCLEREGRFLRNTKVRKM
SAKLLKEYPISSLDDEIFVTKNPNPPGVLKFHPYHPHLVVADRSGVSVLNYESGIRLNQF
DNGNPRTSRICSMDILNAHDVPLLLTGSDDGAVRVWRNYIADSDEKLSLVTAWTALSGMI
PSSRGSGSGLVTDWEQQSGMLLASGDVRIIRIWDVHRELKLQDIPTGADSCVTSLACDSL
RQSLLVAGLGDGSVRIYDRRQPSNDCRVMTLREHQGWVVKVLIHKRGDGNIISGSVDGDI
KFWEPRMATSLKTLPGTVSNLTTLDVHQQADILACGSANQSIKILNLEGEMLSHIRYHEG
FMGQRIGPLKCLSFHPYWPYLAAGSTDSYLSIYSSQKPIPVKFDDLGM
NT seq 3927 nt NT seq  +upstreamnt  +downstreamnt
atgtatggtaatgttgagcttgatgacattaacgaagaaggaaatgaagaagaagataat
gtgttagattggcaacttcctatatgtttcatgaaaaagcgccacaaggaaaaaatagaa
ggaactacattctcacctcaaacatggaaaatgaaagaaaagatgaagacagtaagcgta
aatcttgttttgtgtttaaatattggtgttgatcctccagatattgttaaaacaaatcct
tgtgcgcggatggaatgctggatagatcctttatctttgaatcctcaaaaggcattagaa
ctgattggaaataaattgcaagagcagtatgaaaggtggcaaccaagagctcgatataga
cataaccttgatccaacagtagaagatgtaaagaagttatgtacttctttaagaagaaat
gccaaagaagaaagggtgttatttcattacaatgggcatggtgttccaaggccaactgca
aatggtgaaatctgggtttttaacaaacaatatacacaatacattccactctctatatat
gatttacagacatggatggggagtccttctatatatgtttatgactgctctaatgcagga
ttaatattagaatgttttaaacactttgctcaacaaagagaacaggagtatgagcgtgct
tcagctcaaggatcaaatccaggactcccaccattggttaataactgtatacagttagct
gcttgtggaccaaatgaactattaccaatgatgcctgatcttccagctgatttgttcact
tcatgtttaactacacccataaaagttgctttgcaatggtttgtaagccagcgtatggga
aatttagttccaggaataacagttgatttaatagaaaaaattccgggacagttaaatgat
cgaagaacaccccttggtgaattgtcctggatttttatagctgttacagacactatagca
tggctcacacttcctatagaattatttcaaaaactatttcgtcaagatatgttagttgca
agtttatttagaaattacttgcttgctgaaagagttatgcgttcatattgctgtactcct
gttactagcccaaaacttccacccatgtaccatcatcatatgtggttagcatgggatttg
gcagtagatcagtgtctttcacagttacctgttattattgaggatataaacaagtacaaa
aatagtacttttttttatgagcaacttacagcatttcaagtatggctggctatgggaaga
gaagatagagaaccacctgaacaattgccagttgttctccaggttttgttaagccaagtt
catcgccttagggctttagacttattgggaagatttttagatcttggtccatgggcagtc
aatttggcactttcagtaaatatatcaccttatattttgcgattgttacgcagtcctact
cgagaacttcgaccactattggtgtttattttagcaaaaattcttgctgttgatagtagt
ttccaaactgatcttgtccaagaaaatggtcacaagtattttttatcagttttggcagat
ggctacatgccagcagaacatagaacaactgcaagctttgttttagcaagaatagttcat
gattatcctgctggacaggaagcatgtttgaaaggaaatatgatttcaatatgtcttgag
caactcactgatccccatccgctacttcgccagtggttggctctatgtttaggtttaata
tggaagaactgtgatgcggctcgctggtgtggaataagagatagtgctccagataaaatc
tcaaaacttttaccagatccgcttccagatgtacgcgcagcggctgtgtttgcactagga
acactaataggaaatactggtgatcgatcagaccatgcaaatatgatagatcaaagtgtt
gctacaactcttactacaatgctagcaaatgaaggaagtccacttgttagaaaggaatta
gttgttgctctttacagccacattatgcagtttgaaaatgcatttattggtgttgctgtc
cagtttatggatgatagtagtttacatgattcctctggaccaggtccacgtgatccagaa
acaaaaaaagggtggatattagttcctcaaagtagtgatgccaatattagtgctaatgaa
ccaagttattcaaagaaaagttccggtcaaacattacttcattcaagtcggtcatcaatc
agtctcagcagtatgtatggtagtgttagtccaacggatgatagtcattggtttcgaaca
caaatttttacttcttcacttcatgaaactgtgtataccagagtctggaaagcaatgctt
aatctttccatggacccacatactgaaactgctgatatggctagaaaagttgttaacact
atagcagtcaaggctgctgtcaacataaagccacacaatggttctacttcagtttcaaca
aatgtttcactcccttcttcacccaatacatcagatgaaggagcttctatacatcccaga
cattcaattggagagtttcatcgctcgacttcttttccttctacccctgaacaatattta
aaaaaacaagcaagcataccaacttctttatataggccgcattctgttcaattttctaca
aagagaggaatttttgataaaggtccagatgtatttcccacgagtgatgatgactctgat
gctgatgaagatggaatttctatgcataaacatattcttgttcgcacaaagttttatgaa
tggtgctgtggctattttgcacactcattaatgaagcctagcgacgatgtagacccaaat
agcgctcaatgtctcgaaagagaaggacgattcttaagaaatacaaaagtgcgtaaaatg
tcggcaaaattgcttaaagaatatccaataagttctctagatgatgaaatatttgttacc
aaaaatcctaatccccccggtgtcctaaagtttcacccatatcatccacatcttgttgtg
gcagatagaagtggagtttcagtcttaaattatgaatcaggtattcgccttaatcaattt
gacaacgggaatcccagaacatcaagaatctgttctatggatattttaaatgctcatgat
gtaccattgctgcttactggttcagatgatggagctgtacgagtttggaggaattacata
gctgattcagatgaaaaactaagtttagttactgcttggactgcattatcggggatgatt
ccatctagtagaggctcaggttctggtcttgtgactgattgggagcagcagtctggtatg
ctgttagcatctggtgatgtacgaatcattcggatatgggatgttcacagagaattgaag
ctgcaagacattcctactggtgctgatagctgtgttacaagtcttgcatgtgattcactt
aggcaatctctacttgttgcaggtttaggtgatggttcggtgcgaatatatgatcgcaga
cagccttctaatgactgtcgtgtgatgacattacgtgaacaccaaggttgggttgttaaa
gttttaatacacaaaagaggtgatggaaatatcatcagtggaagtgtagatggtgatata
aagttttgggaacctcgcatggcaacttcgttaaaaactcttcctgggaccgtttcaaac
cttactacattggatgttcatcaacaagcagatattctggcgtgtggttcagctaaccaa
agcataaagatattaaatttggaaggggaaatgctcagccacattcgatatcatgaaggt
tttatggggcaacggattggtcctcttaaatgcttatcttttcatccctattggccttac
ttagctgcgggcagcactgatagttatttatctatatattcttctcaaaaacctattcct
gtgaagtttgatgacttgggtatgtaa

DBGET integrated database retrieval system