KEGG   Hydra vulgaris: 100213048Help
Entry
100213048         CDS       T01080                                 

Definition
acyl-protein thioesterase 1-like
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
hmg  Hydra vulgaris
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hmg00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 208 aa AA seqDB search
MSCPTVLPKAKHTATVIFLHGLGDTGHGWLAALEEIALPYIKYICPNAPVSKVTLNMGMS
MPSWFDIYSLDKDSKADEEGIQNSSKELKKLIIKEEENGIPSDRILVGGFSQGGVVALYT
LLTYEKKLAGCMGLSTYMPLHKKFPSMCNEINKATEIFLAHGDADPVVKYNYGVMTSSLL
KGYYKNTTLNSYSGMAHSSCMKAPFNKS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtccaacagttctccctaaagctaagcacactgcaacagtaatttttcttcat
ggtttaggtgacactggacatggttggctggcggctctagaagaaattgctctcccctac
attaagtacatttgccctaatgcgccagtttcaaaagttactcttaatatgggaatgtct
atgccttcatggtttgatatttattcattagacaaagatagcaaagcagatgaagaagga
attcaaaattcttctaaggaattaaagaaacttattattaaggaagaagaaaatggaatc
ccttcagaccgtattttagttggagggttcagtcaaggtggtgttgttgctctctacaca
cttttgacatatgaaaaaaagttagcagggtgtatgggtttaagcacatacatgcctctt
cataaaaagtttccatcgatgtgtaatgagattaataaagcaactgaaatatttttggct
catggagatgctgatccagttgtaaaatataactatggagtaatgacatcttctttgtta
aaagggtattataaaaataccacactcaattcatacagcggaatggcacatagttcttgc
atgaaagcgccttttaataagagctag

DBGET integrated database retrieval system