KEGG   Hydra vulgaris: 100213048Help
Entry
100213048         CDS       T01080                                 

Definition
acyl-protein thioesterase 1-like
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
hmg  Hydra vulgaris
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100213048
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100213048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 208 aa AA seqDB search
MSCPTVLPKAKHTATVIFLHGLGDTGHGWLAALEEIALPYIKYICPNAPVSKVTLNMGMS
MPSWFDIYSLDKDSKADEEGIQNSSKELKKLIIKEEENGIPSDRILVGGFSQGGVVALYT
LLTYEKKLAGCMGLSTYMPLHKKFPSMCNEINKATEIFLAHGDADPVVKYNYGVMTSSLL
KGYYKNTTLNSYSGMAHSSCMKAPFNKS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtccaacagttctccctaaagctaagcacactgcaacagtaatttttcttcat
ggtttaggtgacactggacatggttggctggcggctctagaagaaattgctctcccctac
attaagtacatttgccctaatgcgccagtttcaaaagttactcttaatatgggaatgtct
atgccttcatggtttgatatttattcattagacaaagatagcaaagcagatgaagaagga
attcaaaattcttctaaggaattaaagaaacttattattaaggaagaagaaaatggaatc
ccttcagaccgtattttagttggagggttcagtcaaggtggtgttgttgctctctacaca
cttttgacatatgaaaaaaagttagcagggtgtatgggtttaagcacatacatgcctctt
cataaaaagtttccatcgatgtgtaatgagattaataaagcaactgaaatatttttggct
catggagatgctgatccagttgtaaaatataactatggagtaatgacatcttctttgtta
aaagggtattataaaaataccacactcaattcatacagcggaatggcacatagttcttgc
atgaaagcgccttttaataagagctag

DBGET integrated database retrieval system