KEGG   Hydra vulgaris: 100213114Help
Entry
100213114         CDS       T01080                                 

Definition
dual specificity mitogen-activated protein kinase kinase 2-like
Orthology
K04369  
mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
hmg  Hydra vulgaris
Pathway
FoxO signaling pathway
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100213114
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100213114
Protein kinases [BR:hmg01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100213114
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 238 aa AA seqDB search
DGGSLDLILKKALRIPENILGIITLAVLKGLAYLREKHSIIHRDVKPSNILVNSLGEIRL
CDFGVSGQLIDSMANTFVGTRSYMSPERLQGTHYSIRSDIWSIGLSLVELALGRYPIPCL
TTEDFIQIFMNPEKGTHVLPPGAKAPPGVTETKSMAIFELLDYIVNEEPPKLPSQYFSND
FCDFVNKCLKKNPNERPDVKELMEHPWMLKAEAEKNTIDFAGWVSSLLLNGNVVQTNV
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
gatggaggttcacttgatttaattttgaaaaaagcacttagaatacctgaaaatatactt
ggcattattaccctagcagttttaaaaggactagcttacttgcgtgaaaaacattccatt
attcacagagatgttaagccatcaaacattttggtcaattcattgggagaaattagactc
tgtgattttggtgtaagtggccagctaattgattcaatggccaacacatttgttggaact
cgatcatatatgtcaccagaacgactgcagggtactcattattccatccgctcagacatt
tggagtattggattgagccttgtagaacttgcattaggacgatatcctattccttgtctt
acaacagaagatttcatacagatattcatgaaccctgagaaaggtacacatgttttacct
cctggagcaaaagctccccctggtgttactgagactaaatcaatggcaatttttgaactc
ctggattacatagtaaatgaggagccacctaaattaccaagtcagtatttttcaaatgat
ttttgtgattttgtcaataaatgtttaaaaaagaatcctaacgaaagaccagatgtaaaa
gaactaatggaacatccgtggatgctcaaagctgaagcagaaaagaatactatcgatttt
gcaggttgggtatcaagtttacttttgaatggaaacgtagttcaaaccaacgtgtaa

DBGET integrated database retrieval system