KEGG   Hydra vulgaris: 100213192Help
Entry
100213192         CDS       T01080                                 

Definition
(RefSeq) histone acetyltransferase KAT5-like
  KO
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100213192
Chromosome [BR:hmg03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100213192
   HAT complexes
    TIP60 complex
     100213192
    NuA4 complex
     100213192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 420 aa AA seqDB search
FYIKDNKRLDEWVSIDRLDLTKIQPPKTEEKKKTLSQQSVSSKQNQNSSKQNPNQISLPG
SPDLEQVNGINLTQFPSSSLVRNKSNSSFGRKRKAVQDEVNFENESSYSKNSENKTSSLR
SGGSMTVHHDDVITRVKNVEMIEVGKHRIKPWYFAPYPIELTRLPCIYICEFCLKYMKSL
TCLRRHREKCTLFHPPGNEIYRKDNTSFFEIDGRKHKAYSQNLCLLAKLFLDHKTLYYDT
DPFLFYVMTEFDSEGFHIVGYFSKEKESSEDYNVACILTLPQYQRNGLGKLLIEFSYELS
KFEGKSGHPEKPLSDLGLLSYRSYWSQTILEILLQLKSEEGATPVITINEICEMTSIRKE
DVISTLQHLNLLQYYKGQYVICITKDVLESHMKSMKKRKIRIDPKCLHWQPKDWSKRGKW
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
ttttatataaaagataacaaacgtcttgatgaatgggttagtattgatcgtctcgatctg
acaaaaatacaacctccaaaaacagaagagaaaaaaaaaactttatcacaacagtctgtg
tcatcaaaacaaaatcaaaattcatcaaaacaaaatccgaaccaaataagcttacctgga
tcacctgaccttgagcaagtaaatggaattaacctaactcagtttccatcatcttccctt
gtgcgaaataaatcaaatagttcttttggtagaaagagaaaggctgttcaagatgaagtt
aattttgaaaatgagagttcatattcaaaaaactcagaaaataaaacaagcagccttcgt
agcggaggaagtatgacagtacatcatgatgatgttataacgcgagtaaaaaatgttgag
atgatagaggttggtaaacatagaatcaaaccctggtactttgctccttatccaattgaa
ttaactcgtctaccgtgtatttatatatgtgaattttgtctaaagtatatgaaaagttta
acatgtcttagaagacatagggaaaaatgcactctttttcaccctcctggaaatgaaata
taccgtaaagataatacatctttttttgagattgatggaagaaaacacaaagcttattca
caaaacctatgtttactagcaaaactgtttcttgatcacaaaacattatactatgataca
gacccctttctgttttatgttatgacagaattcgacagtgaaggttttcacattgttggt
tacttttcaaaggaaaaggagtcaagtgaagactataatgttgcttgtatattaacgcta
ccacaataccaacgaaatggtttaggaaaattgctcatagagttcagttatgagctttca
aagtttgaagggaagtctggacaccctgaaaagccactttcagatttaggtttgttatcc
tatcgcagctattggtcacagacaatcttggagatactactacagctaaaaagtgaagag
ggtgctactcctgttattacaataaacgaaatatgtgagatgacgagtattcgtaaggag
gatgttatttcaactttacagcatctaaacttgcttcagtattataaaggccaatatgtg
atatgtataactaaagacgttcttgaatcgcacatgaaatcaatgaaaaagcgaaaaata
agaattgacccaaaatgtttacattggcagcctaaagattggagtaagagaggcaaatgg
taa

DBGET integrated database retrieval system