KEGG   Hydra vulgaris: 100213308Help
Entry
100213308         CDS       T01080                                 

Definition
cyclin-H-like
Orthology
K06634  
cyclin H
Organism
hmg  Hydra vulgaris
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100213308
  Replication and repair
   03420 Nucleotide excision repair
    100213308
Transcription machinery [BR:hmg03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100213308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 319 aa AA seqDB search
MFHTSSQRKHWIFESIDKINSNRAASNNNFIEMHRKLKPNAKIEYLNPNEEKLLLTYYTQ
FVFNICRRFKPPVPLSLIGTSLSYFKRFYLYTSVMEFHPKDIAYLCVYLACKIDEYNVSI
DQFMEQAVVKRSLNMQKFLIDNELVLLQKLNYHLTVHSPYRPLEGFLIDVKTKKSIPDIE
KHRTNIEQFLTSSLLTDVILLFTPSQLALAAIENGVGREQLIGYLQLTLDTDSIEKVLCK
LKRIQEIVCSIKVADQTEIFAIEDKLKLCKDYENDPFSDLYHQREISRQEAKEMQKRKKF
QELYDIKHAEEKMLAESLD
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtttcacacaagttcacagcgaaagcactggatttttgaaagcattgataaaatcaat
tctaaccgtgctgcatcaaacaataactttatagaaatgcatcgaaaactgaagcctaat
gctaagattgaatatttaaatcctaatgaagaaaaactattgttaacttattatacacaa
tttgtttttaatatttgtcgaaggtttaaaccacctgtacctttatcattaattggtaca
tcattatcttatttcaaacggttttatttatatacttctgttatggaatttcatcctaaa
gatattgcttatctgtgtgtttacttagcatgtaaaattgatgagtataatgtatcaatt
gaccaatttatggagcaagctgttgtcaagcgttctttaaacatgcagaaatttcttatt
gataatgaacttgttttacttcaaaagctaaactaccacttaacagttcatagcccctat
cgtccgcttgaaggttttttaattgacgttaaaacaaagaaaagtatacctgatattgaa
aaacatcgaacaaatatagagcaatttttgactagtagtttgcttaccgatgtaattttg
ctttttactcctagtcaacttgctttagctgcaattgaaaatggcgttggacgagaacaa
ttaattggttatttgcaattaacattagatacagactccattgagaaagttttatgtaag
ctgaaaagaatacaagaaattgtctgcagcattaaagtcgcagatcaaacagaaatcttt
gcaatcgaagataaactgaaattgtgtaaagattatgagaatgatccattttctgatctt
tatcatcaacgcgaaataagtagacaagaagctaaagaaatgcaaaaaaggaaaaaattt
caggagttatatgacattaaacatgctgaagagaaaatgctggctgaatcgcttgattaa

DBGET integrated database retrieval system