KEGG   Hydra vulgaris: 100213308Help
Entry
100213308         CDS       T01080                                 

Definition
(RefSeq) cyclin-H-like
  KO
K06634  cyclin H
Organism
hmg  Hydra vulgaris
Pathway
hmg03022  Basal transcription factors
hmg03420  Nucleotide excision repair
Module
hmg_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100213308
  Replication and repair
   03420 Nucleotide excision repair
    100213308
Transcription machinery [BR:hmg03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100213308
DNA repair and recombination proteins [BR:hmg03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     100213308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N Cyclin_C Rop
Motif
Other DBs
NCBI-GeneID: 100213308
NCBI-ProteinID: XP_002166346
UniProt: T2MFT7
Position
Un
AA seq 319 aa AA seqDB search
MFHTSSQRKHWIFESIDKINSNRAASNNNFIEMHRKLKPNAKIEYLNPNEEKLLLTYYTQ
FVFNICRRFKPPVPLSLIGTSLSYFKRFYLYTSVMEFHPKDIAYLCVYLACKIDEYNVSI
DQFMEQAVVKRSLNMQKFLIDNELVLLQKLNYHLTVHSPYRPLEGFLIDVKTKKSIPDIE
KHRTNIEQFLTSSLLTDVILLFTPSQLALAAIENGVGREQLIGYLQLTLDTDSIEKVLCK
LKRIQEIVCSIKVADQTEIFAIEDKLKLCKDYENDPFSDLYHQREISRQEAKEMQKRKKF
QELYDIKHAEEKMLAESLD
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtttcacacaagttcacagcgaaagcactggatttttgaaagcattgataaaatcaat
tctaaccgtgctgcatcaaacaataactttatagaaatgcatcgaaaactgaagcctaat
gctaagattgaatatttaaatcctaatgaagaaaaactattgttaacttattatacacaa
tttgtttttaatatttgtcgaaggtttaaaccacctgtacctttatcattaattggtaca
tcattatcttatttcaaacggttttatttatatacttctgttatggaatttcatcctaaa
gatattgcttatctgtgtgtttacttagcatgtaaaattgatgagtataatgtatcaatt
gaccaatttatggagcaagctgttgtcaagcgttctttaaacatgcagaaatttcttatt
gataatgaacttgttttacttcaaaagctaaactaccacttaacagttcatagcccctat
cgtccgcttgaaggttttttaattgacgttaaaacaaagaaaagtatacctgatattgaa
aaacatcgaacaaatatagagcaatttttgactagtagtttgcttaccgatgtaattttg
ctttttactcctagtcaacttgctttagctgcaattgaaaatggcgttggacgagaacaa
ttaattggttatttgcaattaacattagatacagactccattgagaaagttttatgtaag
ctgaaaagaatacaagaaattgtctgcagcattaaagtcgcagatcaaacagaaatcttt
gcaatcgaagataaactgaaattgtgtaaagattatgagaatgatccattttctgatctt
tatcatcaacgcgaaataagtagacaagaagctaaagaaatgcaaaaaaggaaaaaattt
caggagttatatgacattaaacatgctgaagagaaaatgctggctgaatcgcttgattaa

DBGET integrated database retrieval system