KEGG   Hydra vulgaris: 100213359Help
Entry
100213359         CDS       T01080                                 

Definition
calcineurin subunit B type 1-like
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
hmg  Hydra vulgaris
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100213359
Protein phosphatases and associated proteins [BR:hmg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100213359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 170 aa AA seqDB search
MGQDYSIPSDMITHFDADEIKRLGKRFRKLDVDNSGTLSIEEFMSLPELQQNPLVQRVIE
IFDTDGNKEIDFKEFIEGVSQFSVKGDKTNKLKFAFKIYDINQDGYISNGELFTVLKMMV
GNNLKEVQLQQIVDKTMIQFDLDKDGKISFDEFALVVGNMDLDKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaagattactctattccatctgatatgataactcattttgatgctgatgaaatc
aaacgactggggaaacgttttcgaaaattagatgttgataattctggaactttatcaatt
gaagagtttatgtcattacctgaactacaacaaaatcctttagtacagcgtgttattgaa
atttttgatactgatggcaataaagagattgattttaaagagtttattgagggagtttca
cagtttagtgttaaaggtgataagactaataaactaaagtttgcttttaaaatttatgac
atcaatcaagatggttatatatccaatggtgaactttttactgttctaaaaatgatggtt
ggaaacaatttgaaagaagtacaacttcaacaaattgttgacaaaacaatgatacagttt
gatttagacaaagatggtaaaatcagtttcgatgagtttgctcttgttgttggaaacatg
gatcttgataagaaaatggtagtcgatgtttag

DBGET integrated database retrieval system