KEGG   Hydra vulgaris: 100213528Help
Entry
100213528         CDS       T01080                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-A-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
hmg  Hydra vulgaris
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:hmg00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 199 aa AA seqDB search
MTTFPQEFYLSFLLGGSCGVLLMVVISEINLSFDNNTKIKSFNAENACLTPEKMTSKEFY
TSNEHSKFIGKFDEPILVNDMNSLHQKSGDAVANVLSEKVRVLCWVMTQPPTIASKAKAV
KNTWGKHCNLLVFMSSVEDKTFPVVGLNVPEGRENLWLKTRAAWKYVYDKHYNDADWFIK
ADDDSFIIVENLRYFVSRY
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatttccacaagagttctatttgtcttttttgctaggaggatcatgtggtgtt
ttacttatggtagttatctctgaaataaatttgagttttgacaataatacaaaaataaaa
agttttaatgctgaaaatgcatgcctaacaccagaaaaaatgactagtaaagaattttat
acttcaaatgaacattctaaatttattggaaagtttgatgaaccaatcttggttaatgat
atgaatagtttgcatcaaaaaagtggagatgctgttgctaatgttttatcagagaaagtc
agagtgctttgctgggttatgacacaacctccaacaattgcttctaaagctaaagctgtt
aaaaatacatggggaaaacattgcaacttgttagtgtttatgagttctgttgaagataaa
acatttccagttgttggtttaaatgttccagaaggtcgggaaaatctatggttaaaaact
agagctgcatggaaatacgtttatgacaagcattataatgatgctgattggtttattaaa
gctgacgacgattctttcattattgttgaaaatttaagatactttgtttcccgatat

DBGET integrated database retrieval system