KEGG   Hydra vulgaris: 100213683Help
Entry
100213683         CDS       T01080                                 

Definition
eukaryotic translation initiation factor 3 subunit J-like
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
hmg  Hydra vulgaris
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100213683
Translation factors [BR:hmg03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100213683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 234 aa AA seqDB search
MTAPVLTLTDKQPDSQWCAAISTEDLDNWDDEDEVEEKKSEVPATVPKKKKPLAEKIKEK
EEKRKQELLAKQKELEAMAESNKELSAEEQLSERIKNQRLQEESDLELAKDAFGVSDIPG
VKTIDNFDPTTKDEFNELSAMIVKKFSKYEDKSEYPVFLETLFRDCCAGVDVEDIKRISN
SLSIVATEKLKLTKVTKSGKKKGASKKDTIKVGKGLKNDMDYGNDDYYEYEDFI
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgactgccccagttcttacattgactgacaaacagcctgactcgcagtggtgtgctgct
atatcgactgaggatttggacaattgggatgatgaagatgaagtagaagaaaaaaaatca
gaagtgccagctactgttccaaagaaaaagaagccattggctgaaaaaattaaagaaaaa
gaagaaaaacgaaaacaagaattacttgctaaacaaaaagaattagaagctatggctgaa
tccaataaagaactaagtgctgaagaacagttatcagaaagaataaaaaatcaaagatta
caagaagaatctgatttagagttagcaaaggatgcttttggtgtgtctgacatacctggt
gtaaagacaattgataattttgatccaactaccaaagatgaatttaacgagctttctgca
atgattgttaaaaaattttcaaaatacgaagataaatcagaatatccagtatttctagaa
acgctgtttcgtgattgctgtgcaggagtcgacgtcgaagacataaagcgtatatcaaat
tcattatctattgttgcgactgaaaaactaaaacttactaaggtaacaaaaagcggaaaa
aagaaaggtgcttcaaaaaaagacaccattaaagttggaaagggtttgaaaaatgatatg
gattacggcaacgatgattattatgaatatgaagattttatataa

DBGET integrated database retrieval system