KEGG   Hydra vulgaris: 100213777Help
Entry
100213777         CDS       T01080                                 

Definition
histone deacetylase 8-like
Orthology
K11405  
histone deacetylase 8 [EC:3.5.1.98]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100213777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 391 aa AA seqDB search
MTSAALEIAYIHSEKYVSICDKHPKVKGRASMVHDLIESYDLLSLMKIVAPFEASCNDLL
TYHTEKYIQTLEFVEKRLVNSIESHEEDCFNEDEINYINEIGLGYDCSLFSNIYLYAKAI
VGGTLSAANCLIDSQAVVSINLNGGWHHARTDEASGFCYVNDIVIGILKLLTKFKKVLYI
DLDVHHGDYVEEAFLYTNKVVTFSIHKFGDGFFPGTGMKNSIGKGKGKYYTINAPLKDGV
DNKMFTYVFKNIFTEVFHCFSPEVIVVQCGADCLTGDPLGSFNLTSEALVDCVKFVLKEK
VPTMILGGGGYNLSNTARCWTQVIAGILNTTLNNDIPEHDKWECYGPDFALSFNPNHKKN
ENSLEYIEDLLSFLKGNIKFMRGFSKNEISI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagctgctttagaaatagcctacattcattctgaaaaatatgtttccatatgc
gacaagcatccaaaagtgaaaggtagagcatccatggtgcatgatcttattgaatcttat
gatttattgtcacttatgaaaatagttgcaccttttgaagcttcttgtaatgatctgttg
acatatcatacagaaaagtatattcagaccttagagtttgtggagaaaagattagttaac
agtattgaatcacatgaggaagattgttttaatgaagatgaaataaattatattaatgaa
attgggttagggtatgactgctcattattttcgaatatatatttgtatgcaaaagctata
gtgggtggcacattatctgccgctaactgtttgattgatagtcaggctgttgtcagtatc
aatcttaatggtggttggcatcatgcacgcactgacgaggcatctggtttctgttatgtg
aacgacatagttatcggcattcttaaacttttaacaaagttcaaaaaagtcctttatatt
gatttagatgttcaccatggagactatgtagaagaagcttttttatatacgaacaaagtt
gtaactttttctattcataaatttggtgatggattttttcctggaactggcatgaaaaat
agtataggcaaaggtaagggtaagtattatacaataaatgccccattgaaagatggtgta
gacaataaaatgttcacatatgtttttaagaatattttcactgaagtttttcattgtttc
tctccggaagtgattgtcgtgcaatgtggagcagattgtttaacgggtgatcctcttggt
tcatttaatttaacaagtgaagctcttgtagattgtgttaaatttgttttaaaagaaaaa
gttccaaccatgatcttaggaggaggtggttataatttatctaataccgcacgttgttgg
acccaagttattgctggaattttaaatacaacattgaataatgatattccagagcatgat
aaatgggaatgctatggaccagattttgctttaagttttaatcccaatcacaaaaaaaat
gagaattctttagaatacattgaagatttgctgtcatttttgaaaggcaacattaaattt
atgagagggttttcaaagaatgaaatttccatatag

DBGET integrated database retrieval system