KEGG   Hydra vulgaris: 100213781Help
Entry
100213781         CDS       T01080                                 

Definition
TNF receptor-associated factor 5-like
Orthology
K03173  
TNF receptor-associated factor 2
Organism
hmg  Hydra vulgaris
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100213781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 604 aa AA seqDB search
MVWGCMNGFGTGELRRIEGTLNQNRYIELLESAMLPSAAKRYDGLIMEEDKLKGYNVKLV
DGFPDKYKCYFCKLVFRDPIQTFRGERACKYCYFSMKRKNPDVCPIDKEPINDNEIFQDK
HLMREIGQLKCYCNNKDAGCLWKGELLEIQKHHDGCDYNQIACDKCNNQILIRNKDFHQS
KECLYRLITCNDCKIPIKANDLENHRLICPMKRVDCPYNCNEKPLFTELFDHFKSCSKLS
INHICPFQLIGCPYQAIDSDNLNNHLKSTDHFLITVSVVKKLKEDYDEMQHELGIEELTS
IADKIEVDNAVIGESISEIDLKLQMLENTRYDGKHLWRITDFRFRFKQAEEGKTLAIHSA
PSFTSRGGYKFCSSNKNIWKMVSSDQAKSHVESFIPDINSSSFQRPVRDMNIAAGCPQFF
PKESLFSPNYLVDDTIFLETIVNSSKYVKASDNQPTVNCSVDTAIIASSDVASNVVAVTD
FEITDFEIADVAINDVAITDVASTVKTTEAQTNVVSITQSNEQCSFEKPFTEELFFARIP
KVRGRPAATKQRAFKMFGNKTTKPSSLMPKISESLQNNTTESSVGQSQQNDNCKECGFER
NVEC
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggtatggggttgcatgaatggtttcgggacgggagaacttcggcgtatcgaaggtact
cttaaccaaaaccgatacatagagttgttggaatcagctatgttgccatctgctgcaaag
cgttatgatggtttaataatggaggaagataaactaaaaggatacaatgtaaaattagta
gacggttttcctgataaatacaaatgttatttttgcaaactagttttccgtgatcctata
caaacattccgtggtgaaagagcctgcaaatattgttattttagtatgaaaaggaagaat
cctgatgtatgccctatagacaaagagcctatcaatgacaatgagatatttcaagataaa
catcttatgagagaaataggacaattgaagtgttattgcaataataaagatgctggatgc
ttatggaaaggagaattgcttgaaattcagaaacaccatgacggatgtgactataatcag
atagcttgcgataagtgtaataatcaaatcctaataagaaataaggattttcaccaaagt
aaagaatgtctatatcgtttgattacttgcaatgattgtaagataccgataaaggcaaat
gacttggagaatcaccgcttaatctgtccaatgaaaagagttgattgtccatataattgt
aatgaaaaacctctttttactgagctgtttgatcactttaaatcatgttctaaactttca
ataaatcacatatgtccttttcaattaattggatgtccctaccaggccattgattcagat
aatctcaataatcatctgaagtccacagatcactttctcattacagtttctgtggtaaaa
aaactgaaagaagattatgatgaaatgcaacatgagttaggaattgaggagttaactagc
attgcagacaagatagaggttgataatgctgtaataggggaaagtatatctgaaattgac
cttaagttacagatgcttgaaaatacaagatacgatggtaaacatttgtggcgaattact
gattttcgtttccgttttaaacaagctgaagaaggtaaaaccttggctattcacagtgca
ccatcatttaccagtcgtggcggttataaattttgcagcagcaataagaacatttggaaa
atggtaagctcagaccaagctaaaagtcacgttgaatcttttataccagatattaattct
tcaagttttcaacgcccagtgagagatatgaatattgctgctggatgtccacaatttttc
cctaaagagtctcttttttcacctaattatcttgtcgatgacaccattttcttagaaact
attgttaattcatcaaagtatgttaaagcttctgacaaccaaccaactgttaattgcagt
gttgacactgccattattgcatctagtgatgttgcatcaaatgttgtcgcagtaactgat
tttgaaataactgattttgaaatagctgatgttgcaataaatgatgttgcaataactgat
gttgcatcaactgttaaaactactgaggctcaaacaaatgttgtttcaataactcaatct
aatgagcagtgttcttttgagaaaccttttacagaagagttattttttgccagaatacca
aaggtccgtggcaggccagctgcgaccaaacagcgagcatttaaaatgtttggtaataaa
acaactaagccatcatctttaatgccaaagatctcagaatctctgcaaaataatacaaca
gaaagtagtgtaggccaatctcaacaaaatgacaattgcaaggaatgtggctttgaaagg
aatgtggaatgttaa

DBGET integrated database retrieval system