KEGG   Hydra vulgaris: 100213781Help
Entry
100213781         CDS       T01080                                 

Definition
(RefSeq) TNF receptor-associated factor 5-like
  KO
K03173  
TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
hmg  Hydra vulgaris
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100213781
Enzymes [BR:hmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100213781
Messenger RNA biogenesis [BR:hmg03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100213781
Ubiquitin system [BR:hmg04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100213781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 514 aa AA seqDB search
MEEDKLKGYNVKLVDGFPDKYKCYFCKLVFRDPIQTFRGERACKYCYFSMKRKNPDVCPI
DKEPINDNEIFQDKHLMREIGQLKCYCNNKDAGCLWKGELLEIQKHHDGCDYNQIACDKC
NNQILIRNKDFHQSKECLYRLITCNDCKIPIKANDLENHRLICPMKRVDCPYNCNEKPLF
TELFDHFKSCSKLSINHICPFQLIGCPYQAIDSDNLNNHLKSTDHFLITVSVVKKLKEDY
DEMQHELGVQQKNFKSLSKKYEKIEIQIKDVRGIIVVLQESLLNLSGTEVSVSDYQIKTF
ETKLNECKEKIDKLLPKKNMDDFLSLRPKIEELTSIADKIEVDNAVIGESISEIDLKLQM
LENTRYDGKHLWRITDFRFRFKQAEEGKTLAIHSAPSFTSRGGYKFCSRLYLNGDGSGSK
THLSLYFVIMKSEYDQLLEWPFKKRVTFRLINVLDQAKSHVESFIPDINSSSFQRPVRDM
NIAAGCPQFFPKESLFSPNYLVDDTIFLETIVSE
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagataaactaaaaggatacaatgtaaaattagtagacggttttcctgataaa
tacaaatgttatttttgcaaactagttttccgtgatcctatacaaacattccgtggtgaa
agagcctgcaaatattgttattttagtatgaaaaggaagaatcctgatgtatgccctata
gacaaagagcctatcaatgacaatgagatatttcaagataaacatcttatgagagaaata
ggacaattgaagtgttattgcaataataaagatgctggatgcttatggaaaggagaattg
cttgaaattcagaaacaccatgacggatgtgactataatcagatagcttgcgataagtgt
aataatcaaatcctaataagaaataaggattttcaccaaagtaaagaatgtctatatcgt
ttgattacttgcaatgattgtaagataccgataaaggcaaatgacttggagaatcaccgc
ttaatctgtccaatgaaaagagttgattgtccatataattgtaatgaaaaacctcttttt
actgagctgtttgatcactttaaatcatgttctaaactttcaataaatcacatatgtcct
tttcaattaattggatgtccctaccaggccattgattcagataatctcaataatcatctg
aagtccacagatcactttctcattacagtttctgtggtaaaaaaactgaaagaagattat
gatgaaatgcaacatgagttaggagttcaacaaaaaaattttaaatcactttcaaaaaaa
tatgaaaaaatagagattcaaattaaagatgttagaggtattatagtagtgttacaagaa
agtttattaaacttgtcaggtactgaggtatcagtgtctgattatcaaattaaaactttt
gaaacaaaattgaacgaatgtaaagaaaaaatagataaacttcttccaaaaaaaaatatg
gatgactttctatctttgcggccaaagattgaggagttaactagcattgcagacaagata
gaggttgataatgctgtaataggggaaagtatatctgaaattgaccttaagttacagatg
cttgaaaatacaagatacgatggtaaacatttgtggcgaattactgattttcgtttccgt
tttaaacaagctgaagaaggtaaaaccttggctattcacagtgcaccatcatttaccagt
cgtggcggttataaattttgcagcagactttatcttaatggtgatggaagtggttcaaaa
acacatttatctctttactttgttattatgaaatccgagtatgaccagctattagaatgg
ccttttaagaaaagagttacttttagattaattaatgttttagaccaagctaaaagtcac
gttgaatcttttataccagatattaattcttcaagttttcaacgcccagtgagagatatg
aatattgctgctggatgtccacaatttttccctaaagagtctcttttttcacctaattat
cttgtcgatgacaccattttcttagaaactattgttagtgaataa

DBGET integrated database retrieval system