KEGG   Hydra vulgaris: 100213799Help
Entry
100213799         CDS       T01080                                 

Definition
cytosolic 10-formyltetrahydrofolate dehydrogenase-like
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
hmg  Hydra vulgaris
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    100213799
Enzymes [BR:hmg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     100213799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 747 aa AA seqDB search
MLSSHCFIAKRYFSKKYFDMAALRIAVIGQSNFGADVYKLLRQKGHEIVGVFTIPDNNGK
KDPLAQVAEHDGVKVFKYARWQLQKIAIPEIVEEYQSLKAEINVMPFCSQFIPAEVVDFP
KHGSIIYHPSLLPRHRGASAVNWTLMSGDKKGGFTIFYADDGLDTGPILLQKETNIAPNE
TVDTLYNRFLYPEGIKGMVEAVELIANGCAPKISQPTEGASYDKIWNKKSLAQINWNQPA
NVLHNFIRGNDKIFYVFAXEVSFFGSSMYLRKSLPEGIPCFIDGLAHPALVHKNGMIITG
SDGLRINVKTLQLSDGKMVPASKFGKENEDKNEIIFTDEDLKLKETLKKIWSGILNIPNI
DDCTNFFKAGAASMDVTRLVEEIKQRCNIFLTNEDIYMHSTXTDVTIKGKSLKMPNQLFI
NGEFVEAESGKTFETLNPSDETVSNNIHXEKLYYKNVNKIEVKKSXXXNSLRKTINKITN
YXLINRLADVMDEHREELAMIESLDSGAVYTLALKTHIGMSIDTFRYFAGWADKIQGETI
PINHARPSKNLCFTKKEPLGVCGLIVPWNYPLMMLAWKMAPLLAAGNTVVLKPAQVTSMT
ALKFAELTVKAGFPKGVINIVPGSGRSVGQAIAEHPDIRKVGFTGSTPVGAGVMRSAADS
NIKKVSLELGGKSPLIIFGDCDMDKAVKQGLLSCIFNKGENCIAAGRIFVEDCIHDEFVN
RVIKEVEKLVIGDPLDLSTSHGPQNHQ
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgctttctagtcattgttttattgcaaaaagatatttttcaaaaaagtactttgatatg
gctgctttgagaatcgctgttataggacaatcaaactttggtgctgatgtgtataagttg
cttcgtcaaaaaggacacgaaatagttggagtttttactattcctgacaataatggtaag
aaggatcctctagctcaagttgctgaacatgatggtgttaaagtatttaagtatgcacga
tggcaacttcaaaaaattgctatacctgaaattgttgaagaatatcagagcttgaaagct
gaaattaatgtgatgcctttttgttcacaatttattccagctgaagtggttgattttcca
aagcatgggtctattatttatcatccttcactgttacctcgtcatagaggtgcttctgct
gtaaattggacattaatgtcaggagataaaaaaggtggttttacaatattctatgcagat
gatggattagatactggacctattttgcttcaaaaagaaactaatattgcaccaaatgaa
actgttgatacattgtataatcgatttttatacccagaaggtatcaaaggaatggtagaa
gcggtagaacttattgctaatggatgtgctccaaaaattagtcaacctactgagggagca
agttatgataagatatggaacaaaaaaagcttagctcagattaattggaatcaaccagca
aatgtattgcacaattttattcgtggaaatgacaagattttttatgtttttgcttaggaa
gtatctttctttggttcatcaatgtacctacgaaaaagtctgcctgaaggaattccatgt
tttattgacggtcttgctcaccctgctttagttcataaaaatggaatgatcataactggt
tcagatggattaagaattaatgtgaaaacactgcaacttagtgatggaaaaatggtacca
gctagtaaatttggtaaagagaatgaagacaaaaatgagattatttttacagatgaagat
ttaaaacttaaagaaactttaaagaaaatttggagtggaattctgaacattcctaatatt
gatgattgcacaaattttttcaaagcaggtgctgcatcaatggatgtaacaagacttgta
gaagaaatcaagcagagatgcaatatttttttaactaatgaagatatttacatgcattca
acgtaaactgatgtaacaattaaaggaaaatcactaaaaatgcctaatcagctttttata
aatggagagtttgttgaagcagagagtgggaaaacatttgaaacattaaatccttctgat
gaaacagtgagtaataacattcactaggaaaaattgtattataaaaatgttaataaaatt
gaagtaaaaaaaagttaataataaaactcactaagaaaaactattaacaaaataacaaac
tattaactaataaatagattagcagatgtaatggatgagcatcgtgaagagttagctatg
attgagtctttggattcaggagctgtatacacattagctttaaaaacacatattggtatg
tcaattgatacatttcgttattttgctggatgggctgacaaaattcagggagaaacaata
cccattaatcatgcacgaccaagtaaaaacttgtgctttacaaagaaagaacctctagga
gtttgcggtttgattgttccatggaactacccacttatgatgttggcttggaaaatggca
cctttattagctgctggaaatacagttgttttaaagccagctcaagttacttcaatgaca
gcattaaagtttgctgagctaacagtaaaggccggttttccaaaaggtgtcatcaatatt
gttcctggttcaggtcgtagtgttggtcaagctattgctgaacatcctgacattaggaaa
gttggttttactggctctacacctgttggagctggtgttatgagaagcgctgctgatagc
aatattaaaaaagtgtcattagagcttggtggaaaatcacccttaatcatttttggtgac
tgtgacatggataaagctgtaaaacagggtttactctcgtgtatttttaacaaaggagaa
aattgcattgcagcaggaagaatttttgttgaagattgtattcatgatgagtttgttaat
agagttatcaaagaagttgaaaaattagttataggtgatcctcttgatctttccacttca
catggaccacaaaatcatcagtaa

DBGET integrated database retrieval system