KEGG   Hydra vulgaris: 100213897Help
Entry
100213897         CDS       T01080                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
hmg  Hydra vulgaris
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100213897
Enzymes [BR:hmg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     100213897
Glycosyltransferases [BR:hmg01003]
 Glycan extension
  Type 3 chain
   100213897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 333 aa AA seqDB search
MRRYFYTDNKIKVFLLGFLVGLIITILLNSWLVEQKDYYPSPTTNDCYKTLTSPAIFNKL
NDLYSKKEETVALKLAQKVRILCWVMTHPVTIYKNAKAARDTWGKRCNIILFMSSVQDDC
FPAVGLGVAEGRENLWLKTRAAWKYIFENHFNDAEWFIKVDDDAFVVLENLRLFLNPYRT
TDPHYFGRHFQTFKGYNSGGAGYVFSKETLRRFVRVMKDPFLCKEVSDFEDKEIGVCLSA
VGIYPEETRDIKGRETFHPFHPLVHVMPGLMKSNNWLYQYSKWEVRIGPECCSDNSIAFH
YIKPNDMYFLNFVLYQVHPFGINHSNVLNYQVQ
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgttacttttatactgacaacaagataaaagttttcttacttggatttttggtt
ggtttaataataacaattttgctaaacagttggttggtggagcaaaaagattactatcct
agtccaactacaaatgattgctacaagactttgacttcaccagcaatattcaataaatta
aatgatttgtattcaaagaaggaagaaactgttgctcttaaacttgctcaaaaagttaga
attttatgttgggtgatgacacatcctgtcacaatttacaaaaatgcaaaggcagcacgt
gatacatggggaaagagatgtaatattattttgtttatgagctctgttcaagatgattgt
tttccagctgttggacttggagtagcagaaggtagagaaaatttatggctgaaaaccaga
gcagcatggaagtatatatttgaaaatcatttcaatgatgctgaatggtttataaaggtt
gatgatgatgcttttgttgttcttgaaaatctacgtttatttttaaatccgtatcgaaca
actgatccccattatttcggacgtcattttcaaactttcaaaggttataatagtggtggt
gctggctatgtgtttagtaaagaaacattgcgcagatttgttcgtgttatgaaagatcca
tttctttgcaaagaagtctcagattttgaagataaagagattggagtttgtcttagtgct
gttggaatatatcctgaagaaacacgagatattaaagggagagaaacattccatccattt
catccattagttcatgtaatgcctggtcttatgaaaagcaataattggttatatcaatac
agtaaatgggaagttcgcataggtcctgaatgctgttcagataacagcattgcatttcac
tacatcaaaccaaatgacatgtattttttaaactttgttctttaccaggttcaccccttt
gggattaatcattctaatgttttaaactaccaagttcagtag

DBGET integrated database retrieval system