KEGG   Hydra vulgaris: 100213931Help
Entry
100213931         CDS       T01080                                 

Definition
dual specificity protein kinase CLK2-like
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100213931
Protein kinases [BR:hmg01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100213931
Spliceosome [BR:hmg03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100213931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 470 aa AA seqDB search
MKMSNRIDILRNDEDEYAYSKKKHRRCSDDKKRSRSRSRSQSSSRRRSSSRSQRRHRRYR
GSSGTRALKRSHDREIRLKQYYNKKHKDLHENENRGRRRNLENGHSSRSSSESTVCTNHQ
VKDDKDGHLIYRSGDWLQNRYEIWSLLGEGTFGKCLECYDRKHDKVIALKVIKNIEKYRE
AAKLELKVLEKLSKKDPEGKHLCIKLLGAFDYHGHVCLAFPKLGKSVFDFLKENLYQPYP
MLHTQHIAYQLLSSVKFLHSIKLTHTDLKPENMLFVDSSYDTHWNEKSRQEVRILHSSEM
RLIDFGSATFDHEHHSTVVSTRHYRAPEVVLELGWSQPCDIWSCGCIIYEVYTGNTLFQT
HDNREHLAMMERTLGKIPSHMIKKSKKTKYFRKGMLDWDEYSSEGKYVKDNCRPLNEYMT
SNRTVHIELFDLLSKMLEYDPDKRITAHEALLHPYFTCLVPRRRNDSSCS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgtctaatcgaatcgatattttacgtaatgatgaagatgaatatgcgtatagt
aagaaaaagcatagaagatgctcagatgataaaaaaagaagtagaagtagaagtagatca
caaagtagcagtcgtcgtcgctcctcatctagaagtcaaagaaggcataggcgttatcga
ggctcgtctggtactcgagctttaaaacgctctcacgacagagaaataagacttaagcag
tattacaacaagaagcacaaagatttgcacgaaaatgagaatagaggaagacgaagaaat
cttgaaaacggacattccagtcgttcatcaagcgaatctactgtttgtactaatcatcaa
gtgaaagatgataaagatggacatcttatatacagatcaggagactggctgcaaaataga
tatgaaatttggtcattgcttggtgaaggaacatttggaaaatgtttagaatgttatgac
aggaaacatgacaaagtaattgctctaaaagttataaagaacattgaaaaatacagagaa
gctgctaaattagaattaaaggttttagaaaaattgtcgaaaaaagatcctgaaggaaaa
cacttgtgtattaaattacttggtgcatttgattatcatggacatgtttgccttgcattt
cctaaacttggaaagagtgtttttgattttttgaaagaaaatttatatcaaccttatcca
atgcttcatacccaacatattgcctatcaattgttatcgtctgttaagtttctgcacagt
attaaacttactcatactgatttaaaaccagaaaatatgttgtttgttgattcatcatat
gatacccattggaatgaaaaatctagacaagaagttcggatactgcatagctcagaaatg
cgcctaattgattttggctctgccacatttgaccatgaacatcatagtactgttgtatct
acaagacattaccgcgctccagaagttgtattagaattaggctggtctcaaccatgtgac
atttggagttgtggttgtattatctatgaagtgtatactggcaacacattgtttcagacg
catgataatcgggaacatttagcaatgatggaaagaactttaggcaagataccaagtcat
atgataaaaaaatcgaagaaaactaaatatttccgtaaaggaatgttagattgggatgag
tatagctcagaaggaaaatatgtaaaggataactgtagaccattaaatgaatacatgact
tcgaatcgaacagttcatatcgaattatttgatttactcagtaaaatgttagagtatgat
cccgacaaacgaattactgctcatgaggcgcttcttcatccgtatttcacgtgtctcgta
cctaggcgtcgcaacgactcgagttgctcataa

DBGET integrated database retrieval system