KEGG   Hydra vulgaris: 100214070Help
Entry
100214070         CDS       T01080                                 

Definition
replication protein A 32 kDa subunit-like
Orthology
K10739  
replication factor A2
Organism
hmg  Hydra vulgaris
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100214070
   03420 Nucleotide excision repair
    100214070
   03430 Mismatch repair
    100214070
   03440 Homologous recombination
    100214070
   03460 Fanconi anemia pathway
    100214070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 267 aa AA seqDB search
MNYQGFHGNYQGGDGGFMSPGVGSPAIDSSQKKKNRSQTLLPITAAIFHKAEYNSTEDVF
RHDDIDIHQVTIVGVIREVQEAATNISYKIDDMTGDLVSVRKWIDAEDPSDNLKRSECRE
DTYVRVVGNMKSFNDGQMRSVMAFSLVPIKDFDEISFHFLDVIYANLSLKKAPNLSIANN
NTDAPLNRFSNDPLGGGFNDAGLTGNNKVVFNYISACTAEQGISIMELKQKTKNIGEVQL
RNSLEWLSNEGHIYSTIDDDHFRSTSN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaactatcagggttttcatggaaattaccagggtggtgatggtggttttatgagccct
ggtgttggatcacctgcaatagacagttcacaaaaaaagaaaaatagatcacaaacttta
ttacctattaccgccgcaatttttcacaaagcagaatataattcaacagaagatgttttt
cgtcatgatgacatagatattcatcaagttactatagttggtgtcattcgtgaagtccag
gaagctgctacaaatatttcatataaaatagatgatatgactggtgatttagtttcagtt
agaaagtggattgatgcggaagatccaagcgacaatttaaaaagatcagagtgtagagaa
gatacctatgttcgtgttgttggtaatatgaaatcatttaatgatggtcaaatgagaagt
gtaatggcatttagtttagtgcctattaaagattttgatgaaatttcttttcattttttg
gatgttatatatgctaatttaagtctgaaaaaggcacccaacctttcgattgcaaataat
aatacagatgcacccttgaatagatttagtaatgatccattaggaggtggctttaatgat
gctggtttaactggtaacaataaagttgtgttcaattacatttcagcatgtacagctgag
caaggaattagcattatggagttaaaacaaaagactaagaatattggtgaagttcagtta
agaaatagtttagaatggttaagcaatgaagggcatatttattccacaatcgacgatgat
cattttcgttctacttcaaattga

DBGET integrated database retrieval system