KEGG   Hydra vulgaris: 100214070Help
Entry
100214070         CDS       T01080                                 

Definition
replication protein A 32 kDa subunit-like
Orthology
K10739  
replication factor A2
Organism
hmg  Hydra vulgaris
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:hmg03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:hmg03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:hmg03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hmg03440]
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:hmg03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 267 aa AA seqDB search
MNYQGFHGNYQGGDGGFMSPGVGSPAIDSSQKKKNRSQTLLPITAAIFHKAEYNSTEDVF
RHDDIDIHQVTIVGVIREVQEAATNISYKIDDMTGDLVSVRKWIDAEDPSDNLKRSECRE
DTYVRVVGNMKSFNDGQMRSVMAFSLVPIKDFDEISFHFLDVIYANLSLKKAPNLSIANN
NTDAPLNRFSNDPLGGGFNDAGLTGNNKVVFNYISACTAEQGISIMELKQKTKNIGEVQL
RNSLEWLSNEGHIYSTIDDDHFRSTSN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaactatcagggttttcatggaaattaccagggtggtgatggtggttttatgagccct
ggtgttggatcacctgcaatagacagttcacaaaaaaagaaaaatagatcacaaacttta
ttacctattaccgccgcaatttttcacaaagcagaatataattcaacagaagatgttttt
cgtcatgatgacatagatattcatcaagttactatagttggtgtcattcgtgaagtccag
gaagctgctacaaatatttcatataaaatagatgatatgactggtgatttagtttcagtt
agaaagtggattgatgcggaagatccaagcgacaatttaaaaagatcagagtgtagagaa
gatacctatgttcgtgttgttggtaatatgaaatcatttaatgatggtcaaatgagaagt
gtaatggcatttagtttagtgcctattaaagattttgatgaaatttcttttcattttttg
gatgttatatatgctaatttaagtctgaaaaaggcacccaacctttcgattgcaaataat
aatacagatgcacccttgaatagatttagtaatgatccattaggaggtggctttaatgat
gctggtttaactggtaacaataaagttgtgttcaattacatttcagcatgtacagctgag
caaggaattagcattatggagttaaaacaaaagactaagaatattggtgaagttcagtta
agaaatagtttagaatggttaagcaatgaagggcatatttattccacaatcgacgatgat
cattttcgttctacttcaaattga

DBGET integrated database retrieval system