KEGG   Hydra vulgaris: 100214157Help
Entry
100214157         CDS       T01080                                 

Definition
eukaryotic translation initiation factor 4E-like
Orthology
K03259  
translation initiation factor 4E
Organism
hmg  Hydra vulgaris
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100214157
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100214157
Translation factors [BR:hmg03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100214157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 213 aa AA seqDB search
MVETKLDMDDLNNEQELDNNQDVQLSKEIYSKHPLQNTWALWFYKNEKSKSWEANQRVVT
TFETVEDFWAIYNHIQLASKLTLGCDYALFKEGIKPMWEDARNRMGGRWLVSLNRNQRTT
DLDRLWLETLLCLIGEAFGDDSDQVCGAVVNIRIKGDKLAMWTSLAENVDSVLKIGRCYK
ERLTLSQKYLITYEQHIDTATKTGSQSKNKFTL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaacaaaattagatatggatgatttaaataatgaacaagaacttgataacaat
caggatgttcaattatcaaaagagatatattcaaagcatccacttcaaaatacgtgggct
ttatggttttataaaaatgaaaaaagtaaatcttgggaagcaaaccagcgtgttgtcaca
acatttgaaacagtcgaagacttctgggccatatataatcatattcaactagctagtaaa
ttaactcttggttgtgattatgctctttttaaggagggtattaaaccaatgtgggaggat
gcaagaaacagaatgggtggaaggtggcttgttagtttaaatagaaatcaacgaacaact
gatcttgatagattatggttagaaacactgttatgtttaattggagaagcttttggcgac
gattctgatcaagtttgtggagcagttgttaatattagaattaaaggtgataaactggct
atgtggacttctctagctgaaaatgtagattccgtacttaaaatagggcgctgctataaa
gaaagattaactctatctcaaaaatatcttattacttatgagcaacacattgatacagcg
acaaaaactggatcacaatcaaaaaataaatttaccttgtag

DBGET integrated database retrieval system