KEGG   Hydra vulgaris: 100214301Help
Entry
100214301         CDS       T01080                                 

Definition
(RefSeq) josephin-2-like
  KO
K15235  
josephin [EC:3.4.19.12]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100214301
Peptidases [BR:hmg01002]
 Cysteine Peptidases
  Family C86
   100214301
Ubiquitin system [BR:hmg04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    100214301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 172 aa AA seqDB search
MSSIYHEKQRSQLCAVHAINNLFQDGLLCSKNKLDKLCLQLDPSVLMNQHRSMFGTGNYD
INVIMVFLNDQGYDVIWFDKRKTLNEINIDEIVGFLVNTLSSYKVFGRSINLFLFKHWYA
IRSLNGIYFNLDSKLQSPMKIGDRDSVLKYLNEIINEGHNELLIVVKKGSVA
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgagttctatttaccatgaaaaacaaagatcacaattatgtgctgtacatgctatcaat
aatttatttcaagatggtttattgtgcagtaaaaataaacttgataagttatgtcttcaa
ctcgatccttcagtattaatgaaccaacaccgaagtatgtttggtacaggaaattatgac
ataaatgttataatggtttttttaaatgaccagggttatgatgtaatttggtttgataaa
agaaaaactttgaatgaaatcaatattgatgaaattgtcggcttcctggtcaacacactt
tcatcatataaagtttttggaagatctattaatttgtttttgtttaaacattggtatgcc
attcgaagtttaaatggtatttattttaatctggattcaaagctgcaatctccaatgaag
attggtgatagagattcagttttaaagtatcttaatgaaattattaatgaaggtcataat
gaactattgatagttgtaaagaaaggtagtgtagcctaa

DBGET integrated database retrieval system