KEGG   Hydra vulgaris: 100214301Help
Entry
100214301         CDS       T01080                                 

Definition
josephin-2-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
hmg  Hydra vulgaris
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 176 aa AA seqDB search
MSSIYHEKQRSQLCAVHAINNLFQDGLLCSKNKLDKLCLQLDPSVLMNQHRSMFGTGNYD
INVIMVFLNDQGYDVIWFDKRKTLNEINIDEIVGFLVNTLSSYKVFGRSINLFLFKHWYA
IRSLNGIYFNLDSKLQSPMKIGDRDSVLKYLNEIINEGHNELLIVVKKGNEKFTFS
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgagttctatttaccatgaaaaacaaagatcacaattatgtgctgtacatgctatcaat
aatttatttcaagatggtttattgtgcagtaaaaataaacttgataagttatgtcttcaa
ctcgatccttcagtattaatgaaccaacaccgaagtatgtttggtacaggaaattatgac
ataaatgttataatggtttttttaaatgaccagggttatgatgtaatttggtttgataaa
agaaaaactttgaatgaaatcaatattgatgaaattgtcggcttcctggtcaacacactt
tcatcatataaagtttttggaagatctattaatttgtttttgtttaaacattggtatgcc
attcgaagtttaaatggtatttattttaatctggattcaaagctgcaatctccaatgaag
attggtgatagagattcagttttaaagtatcttaatgaaattattaatgaaggtcataat
gaactattgatagttgtaaagaaaggtaatgagaaatttactttctcttga

DBGET integrated database retrieval system